Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1435
Gene name Gene Name - the full gene name approved by the HGNC.	Colony stimulating factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CSF1
Synonyms (NCBI Gene) Gene synonyms aliases	CSF-1, MCSF, PG-M-CSF
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolyti

Show/Hide all(178)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay, Western blot	18823650
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay, Western blot	18823650
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay	18823650
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay	18823650
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay	14697198
MIRT006200	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, qRT-PCR	22005523
MIRT006200	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, qRT-PCR	22005523
MIRT006200	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, qRT-PCR	22005523
MIRT007318	hsa-miR-148b-3p	Western blot	23238785
MIRT007318	hsa-miR-148b-3p	Western blot	23238785
MIRT007318	hsa-miR-148b-3p	Western blot	23238785
MIRT007318	hsa-miR-148b-3p	Western blot	23238785
MIRT016979	hsa-miR-335-5p	Microarray	18185580
MIRT004575	hsa-miR-130a-3p	Reporter assay	14697198
MIRT047860	hsa-miR-30c-5p	CLASH	23622248
MIRT046121	hsa-miR-30b-5p	CLASH	23622248
MIRT041071	hsa-miR-505-3p	CLASH	23622248
MIRT052998	hsa-miR-128-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22909061
MIRT052998	hsa-miR-128-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22909061
MIRT053188	hsa-miR-152-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22909061
MIRT052998	hsa-miR-128-3p	Flow, qRT-PCR, Western blot	23019226
MIRT052998	hsa-miR-128-3p	Luciferase reporter assay, Western blot	24415783
MIRT053188	hsa-miR-152-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22909061
MIRT007318	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007318	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007318	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT569797	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT569796	hsa-miR-3135b	PAR-CLIP	20371350
MIRT569795	hsa-miR-5580-5p	PAR-CLIP	20371350
MIRT569794	hsa-miR-184	PAR-CLIP	20371350
MIRT569793	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT569791	hsa-miR-4306	PAR-CLIP	20371350
MIRT569792	hsa-miR-4644	PAR-CLIP	20371350
MIRT569790	hsa-miR-5192	PAR-CLIP	20371350
MIRT569789	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT569788	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT569787	hsa-miR-765	PAR-CLIP	20371350
MIRT569786	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT569785	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT732200	hsa-miR-1207-5p	5.0	27107415
MIRT732200	hsa-miR-1207-5p	5.0	27107415
MIRT732200	hsa-miR-1207-5p	5.0	27107415
MIRT569797	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT569796	hsa-miR-3135b	PAR-CLIP	20371350
MIRT569795	hsa-miR-5580-5p	PAR-CLIP	20371350
MIRT569794	hsa-miR-184	PAR-CLIP	20371350
MIRT569793	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT569791	hsa-miR-4306	PAR-CLIP	20371350
MIRT569792	hsa-miR-4644	PAR-CLIP	20371350
MIRT569790	hsa-miR-5192	PAR-CLIP	20371350
MIRT569789	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT569788	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT569787	hsa-miR-765	PAR-CLIP	20371350
MIRT569786	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT569785	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT911659	hsa-miR-1972	CLIP-seq
MIRT911660	hsa-miR-4650-5p	CLIP-seq
MIRT911661	hsa-miR-4681	CLIP-seq
MIRT911662	hsa-miR-148a	CLIP-seq
MIRT911663	hsa-miR-148b	CLIP-seq
MIRT911664	hsa-miR-152	CLIP-seq
MIRT911665	hsa-miR-198	CLIP-seq
MIRT911666	hsa-miR-214	CLIP-seq
MIRT911667	hsa-miR-223	CLIP-seq
MIRT911668	hsa-miR-3155	CLIP-seq
MIRT911669	hsa-miR-3155b	CLIP-seq
MIRT911670	hsa-miR-3166	CLIP-seq
MIRT911671	hsa-miR-3619-5p	CLIP-seq
MIRT911672	hsa-miR-3620	CLIP-seq
MIRT911673	hsa-miR-4284	CLIP-seq
MIRT911674	hsa-miR-4300	CLIP-seq
MIRT911675	hsa-miR-4437	CLIP-seq
MIRT911676	hsa-miR-4530	CLIP-seq
MIRT911677	hsa-miR-4537	CLIP-seq
MIRT911678	hsa-miR-4685-5p	CLIP-seq
MIRT911679	hsa-miR-4697-3p	CLIP-seq
MIRT911680	hsa-miR-4771	CLIP-seq
MIRT911681	hsa-miR-483-3p	CLIP-seq
MIRT911682	hsa-miR-484	CLIP-seq
MIRT911683	hsa-miR-520a-5p	CLIP-seq
MIRT911684	hsa-miR-525-5p	CLIP-seq
MIRT911685	hsa-miR-634	CLIP-seq
MIRT911686	hsa-miR-761	CLIP-seq
MIRT911687	hsa-miR-920	CLIP-seq
MIRT1970282	hsa-miR-1228	CLIP-seq
MIRT1970283	hsa-miR-1247	CLIP-seq
MIRT1970284	hsa-miR-1266	CLIP-seq
MIRT911668	hsa-miR-3155	CLIP-seq
MIRT911669	hsa-miR-3155b	CLIP-seq
MIRT1970285	hsa-miR-3664-3p	CLIP-seq
MIRT1970286	hsa-miR-4518	CLIP-seq
MIRT911682	hsa-miR-484	CLIP-seq
MIRT1970283	hsa-miR-1247	CLIP-seq
MIRT2206213	hsa-miR-1268	CLIP-seq
MIRT2206214	hsa-miR-1268b	CLIP-seq
MIRT2206215	hsa-miR-23a	CLIP-seq
MIRT2206216	hsa-miR-23b	CLIP-seq
MIRT2206217	hsa-miR-23c	CLIP-seq
MIRT2206218	hsa-miR-4486	CLIP-seq
MIRT2206219	hsa-miR-4492	CLIP-seq
MIRT2206220	hsa-miR-4498	CLIP-seq
MIRT2206221	hsa-miR-4505	CLIP-seq
MIRT2206222	hsa-miR-4508	CLIP-seq
MIRT2206223	hsa-miR-585	CLIP-seq
MIRT2206224	hsa-miR-762	CLIP-seq
MIRT2386495	hsa-miR-4514	CLIP-seq
MIRT2386496	hsa-miR-4692	CLIP-seq
MIRT2386497	hsa-miR-4736	CLIP-seq
MIRT2436480	hsa-miR-1200	CLIP-seq
MIRT2386495	hsa-miR-4514	CLIP-seq
MIRT2386496	hsa-miR-4692	CLIP-seq
MIRT2386497	hsa-miR-4736	CLIP-seq
MIRT2436481	hsa-miR-4763-3p	CLIP-seq
MIRT2436482	hsa-miR-544b	CLIP-seq
MIRT2509433	hsa-miR-125a-5p	CLIP-seq
MIRT2509434	hsa-miR-125b	CLIP-seq
MIRT2509435	hsa-miR-3126-5p	CLIP-seq
MIRT911668	hsa-miR-3155	CLIP-seq
MIRT911669	hsa-miR-3155b	CLIP-seq
MIRT2509436	hsa-miR-3165	CLIP-seq
MIRT2509437	hsa-miR-3183	CLIP-seq
MIRT2509438	hsa-miR-326	CLIP-seq
MIRT2509439	hsa-miR-330-5p	CLIP-seq
MIRT2509440	hsa-miR-3616-3p	CLIP-seq
MIRT2509441	hsa-miR-3944-5p	CLIP-seq
MIRT2509442	hsa-miR-4268	CLIP-seq
MIRT2509443	hsa-miR-4319	CLIP-seq
MIRT2509444	hsa-miR-4419a	CLIP-seq
MIRT2509445	hsa-miR-4436b-3p	CLIP-seq
MIRT2509446	hsa-miR-4456	CLIP-seq
MIRT2509447	hsa-miR-4459	CLIP-seq
MIRT2509448	hsa-miR-4510	CLIP-seq
MIRT2386495	hsa-miR-4514	CLIP-seq
MIRT2386496	hsa-miR-4692	CLIP-seq
MIRT2509449	hsa-miR-4723-3p	CLIP-seq
MIRT2386497	hsa-miR-4736	CLIP-seq
MIRT2509450	hsa-miR-4779	CLIP-seq
MIRT911682	hsa-miR-484	CLIP-seq
MIRT2436482	hsa-miR-544b	CLIP-seq
MIRT2509451	hsa-miR-665	CLIP-seq
MIRT2509452	hsa-miR-940	CLIP-seq
MIRT2678685	hsa-miR-128	CLIP-seq
MIRT2678686	hsa-miR-130a	CLIP-seq
MIRT2678687	hsa-miR-130b	CLIP-seq
MIRT911662	hsa-miR-148a	CLIP-seq
MIRT911663	hsa-miR-148b	CLIP-seq
MIRT911664	hsa-miR-152	CLIP-seq
MIRT2678688	hsa-miR-1909	CLIP-seq
MIRT2678689	hsa-miR-27a	CLIP-seq
MIRT2678690	hsa-miR-27b	CLIP-seq
MIRT2678691	hsa-miR-301a	CLIP-seq
MIRT2678692	hsa-miR-301b	CLIP-seq
MIRT911668	hsa-miR-3155	CLIP-seq
MIRT911669	hsa-miR-3155b	CLIP-seq
MIRT2509436	hsa-miR-3165	CLIP-seq
MIRT2509437	hsa-miR-3183	CLIP-seq
MIRT2509438	hsa-miR-326	CLIP-seq
MIRT2509439	hsa-miR-330-5p	CLIP-seq
MIRT2509440	hsa-miR-3616-3p	CLIP-seq
MIRT2678693	hsa-miR-3666	CLIP-seq
MIRT2678694	hsa-miR-4255	CLIP-seq
MIRT2509442	hsa-miR-4268	CLIP-seq
MIRT2678695	hsa-miR-4295	CLIP-seq
MIRT2509445	hsa-miR-4436b-3p	CLIP-seq
MIRT2509446	hsa-miR-4456	CLIP-seq
MIRT2509447	hsa-miR-4459	CLIP-seq
MIRT2386495	hsa-miR-4514	CLIP-seq
MIRT2678696	hsa-miR-454	CLIP-seq
MIRT2678697	hsa-miR-4645-5p	CLIP-seq
MIRT2678698	hsa-miR-4673	CLIP-seq
MIRT2386496	hsa-miR-4692	CLIP-seq
MIRT2509449	hsa-miR-4723-3p	CLIP-seq
MIRT2678699	hsa-miR-4733-3p	CLIP-seq
MIRT2386497	hsa-miR-4736	CLIP-seq
MIRT911682	hsa-miR-484	CLIP-seq
MIRT2678700	hsa-miR-513a-5p	CLIP-seq
MIRT2509451	hsa-miR-665	CLIP-seq
MIRT2509452	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
ABL1	Activation	23418320
ABL1	Unknown	18619508
CEBPA	Unknown	9632776
JUN	Activation	7642615
NFKB1	Activation	18566389
NFKB1	Unknown	11949945
PPARG	Repression	18566389
RELA	Activation	18566389
RELA	Unknown	11949945
RUNX1	Unknown	9632776
SPI1	Unknown	9632776

Show/Hide all(60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001954	Process	Positive regulation of cell-matrix adhesion	ISS	18566389
GO:0002158	Process	Osteoclast proliferation	IEA
GO:0002931	Process	Response to ischemia	IDA	8922060
GO:0003006	Process	Developmental process involved in reproduction	ISS	19017797
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005125	Function	Cytokine activity	IDA	2460758, 10652277
GO:0005157	Function	Macrophage colony-stimulating factor receptor binding	ISS	19017797
GO:0005157	Function	Macrophage colony-stimulating factor receptor binding	TAS	2460758
GO:0005515	Function	Protein binding	IPI	22153499, 22483114, 22826234, 22902366, 25416956, 26235028, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	2460758
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IDA	19100238
GO:0008083	Function	Growth factor activity	IDA	2460758
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10652277
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2460758
GO:0010628	Process	Positive regulation of gene expression	IDA	1739124, 10666185
GO:0010743	Process	Regulation of macrophage derived foam cell differentiation	NAS	18566389
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	17244792
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IDA	19100238
GO:0016020	Component	Membrane	NAS	2460758
GO:0016021	Component	Integral component of membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030225	Process	Macrophage differentiation	TAS	2460758
GO:0030278	Process	Regulation of ossification	IEA
GO:0030316	Process	Osteoclast differentiation	IBA	21873635
GO:0030316	Process	Osteoclast differentiation	IDA	18606301
GO:0030335	Process	Positive regulation of cell migration	ISS	18566389
GO:0032270	Process	Positive regulation of cellular protein metabolic process	IDA	1739124
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IDA	2460758
GO:0038145	Process	Macrophage colony-stimulating factor signaling pathway	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042117	Process	Monocyte activation	NAS	18566389
GO:0042488	Process	Positive regulation of odontogenesis of dentin-containing tooth	IEA
GO:0042802	Function	Identical protein binding	IPI	22153499, 22902366
GO:0042803	Function	Protein homodimerization activity	IDA	3264878
GO:0043687	Process	Post-translational protein modification	TAS
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045087	Process	Innate immune response	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IBA	21873635
GO:0045651	Process	Positive regulation of macrophage differentiation	IDA	2460758
GO:0045657	Process	Positive regulation of monocyte differentiation	ISS	18566389
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	15304486
GO:0045860	Process	Positive regulation of protein kinase activity	ISS	18566389
GO:0046579	Process	Positive regulation of Ras protein signal transduction	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	1739124
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0060611	Process	Mammary gland fat development	IEA
GO:0060763	Process	Mammary duct terminal end bud growth	IEA
GO:0061518	Process	Microglial cell proliferation	IEA
GO:1901215	Process	Negative regulation of neuron death	IDA	8922060
GO:1902228	Process	Positive regulation of macrophage colony-stimulating factor signaling pathway	IDA	19100238
GO:1904141	Process	Positive regulation of microglial cell migration	IDA	19100238
GO:1990682	Component	CSF1-CSF1R complex	ISS	19017797

MIM	HGNC	e!Ensembl
120420	2432	ENSG00000184371

Protein

UniProt ID

P09603

Protein name

Macrophage colony-stimulating factor 1 (CSF-1) (M-CSF) (MCSF) (Lanimostim) (Proteoglycan macrophage colony-stimulating factor) (PG-M-CSF) [Cleaved into: Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subuni

Protein function

Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammato

PDB

1HMC , 3UEZ , 3UF2 , 4ADF , 4FA8 , 4WRL , 4WRM , 5LXF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05337	CSF-1	41 → 180	Macrophage colony stimulating factor-1 (CSF-1)	Domain

Sequence

MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
HERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
SPLTQDDRQVELPV

Sequence length

554

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor PI3K-Akt signaling pathway Osteoclast differentiation Hematopoietic cell lineage TNF signaling pathway Alzheimer disease Pathways of neurodegeneration - multiple diseases Rheumatoid arthritis		Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Other interleukin signaling Interleukin-10 signaling Post-translational protein phosphorylation

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	16618760
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	16618760
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	16618760
Paget disease	Osteitis Deformans	rs796051862, rs796051869, rs796051870, rs796052213, rs1555767678, rs869025582	20436471

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome	GWAS
Diabetes	Diabetes	GWAS
Otosclerosis	Otosclerosis	GWAS

Show/Hide Text Mining Associations (197)

Disease Name	Relationship Type	References
Associations from Text Mining
Acidosis Lactic	Associate	31924656
Acute Disease	Associate	38045696
Adamantinoma	Associate	21983933
Adenocarcinoma	Associate	1695482
Adenocarcinoma of Lung	Associate	36221069, 38266813
Alveolitis Extrinsic Allergic	Associate	37833889
Alzheimer Disease	Associate	21942811, 32255787
Amyotrophic Lateral Sclerosis	Associate	18389210
Amyotrophic Lateral Sclerosis	Inhibit	32586411
Anemia Refractory	Associate	3495006
Aneurysm	Stimulate	26539497
Anti N Methyl D Aspartate Receptor Encephalitis	Associate	36389787
Aortic Aneurysm Abdominal	Associate	17321344
Aortic Diseases	Associate	22479353
Arthritis	Associate	33679701, 35255727
Arthritis Psoriatic	Stimulate	20796300
Arthritis Rheumatoid	Associate	12384915, 15485996, 25652333, 34239365, 38283352
Asthma	Stimulate	37249291
Asthma	Associate	40696647
Atherosclerosis	Associate	19008293, 20335529, 40489880, 7622526
Atherosclerosis	Inhibit	8394386
Axial osteomalacia	Associate	40165259
Axial Spondyloarthritis	Associate	30522483
Basal Ganglia Hemorrhage	Associate	28682428
Blast Injuries	Associate	31621494
Bone Cysts Aneurysmal	Associate	22330339
Bone Resorption	Associate	21467819, 25302610, 30417373
Bone Resorption	Stimulate	8916970
Breast Neoplasms	Associate	11956031, 19188147, 19949854, 23233531, 24342436, 35456396
Cakut	Associate	39237660
Carcinoma	Associate	15117969, 2663797
Carcinoma Endometrioid	Associate	24263966
Carcinoma Giant Cell	Associate	35697931
Carcinoma Hepatocellular	Associate	35637248, 37097499, 38015590
Carcinoma Hepatocellular	Inhibit	39173282
Carcinoma Non Small Cell Lung	Associate	24907005, 38176297
Carcinoma Non Small Cell Lung	Stimulate	37638687
Carcinoma Ovarian Epithelial	Associate	9376277
Carcinoma Pancreatic Ductal	Associate	32173982
Carcinoma Renal Cell	Associate	11092615, 25886010, 29734839, 34002666
Carcinoma Renal Cell	Inhibit	9845545
Carotid Stenosis	Associate	20796300
Central Nervous System Diseases	Associate	21895511
Cerebral Infarction	Stimulate	10072108
Chromosome Aberrations	Associate	1912583
Chronic Kidney Disease Mineral and Bone Disorder	Associate	28784837
Cognition Disorders	Associate	34652888
Common Variable Immunodeficiency	Stimulate	34146579
Coronary Artery Disease	Associate	22780915, 24699314, 37304261
Coronary Artery Disease	Stimulate	30012324
COVID 19	Stimulate	33194826
COVID 19	Associate	34489933, 34504502, 36148234, 39940787
Coxa Magna	Associate	33542623
Crohn Disease	Associate	28273887
Dermatitis Atopic	Associate	28821884
Diabetes Mellitus Type 2	Associate	35281591
Disease	Stimulate	2663797
Drug Related Side Effects and Adverse Reactions	Associate	10820252
Endometrial Neoplasms	Associate	2663797, 30816518, 35762530, 8605095
Endometriosis	Associate	21481374, 22365076
Enterocolitis Necrotizing	Inhibit	39342173
Esophageal Squamous Cell Carcinoma	Associate	37676642
Essential Tremor	Associate	36266510
Fibrosis	Inhibit	34006921
Giant Cell Arteritis	Associate	39817309
Giant Cell Tumor of Bone	Associate	36007098
Giant Cell Tumor of Tendon Sheath	Associate	16407111, 19443701, 24604026, 26222558, 27041409, 30152874, 30206409, 30594158, 34716196, 34855235, 35443852, 36007098, 36099115, 36320082, 36502356, 36504457 View all (1 more)
Giant Cell Tumor of Tendon Sheath	Stimulate	19188147
Giant Cell Tumors	Associate	36320082
Gingival Overgrowth	Associate	32455102
Glioblastoma	Associate	21649900, 26245897
Glioma	Associate	17318194, 22957741, 26245897
Glomerulonephritis Membranous	Associate	37876929
Granulomatosis with Polyangiitis	Associate	22905158
Hemangioma capillary infantile	Stimulate	28438094
Hematologic Neoplasms	Associate	1912583
Hemolytic Uremic Syndrome	Associate	9067911
Hemophilia A	Associate	30650445
Hepatitis Autoimmune	Associate	37108648
Hereditary Breast and Ovarian Cancer Syndrome	Associate	32393308
Hereditary leiomyomatosis and renal cell cancer	Associate	1632458
Histiocytosis Langerhans Cell	Stimulate	1771606
Histiocytosis Langerhans Cell	Associate	32238382
Hodgkin Disease	Associate	1632458
Hydatidiform Mole	Associate	8188522
Hyperostosis corticalis deformans juvenilis	Associate	25891874
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	33549023
Hypoxia	Stimulate	28438094
Hypoxia	Associate	33737938
Idiopathic Pulmonary Fibrosis	Stimulate	33746960
Infections	Stimulate	25404022
Infections	Associate	26990868, 39342173
Inflammation	Associate	21481374, 21625498, 24916404, 25652333, 26990868, 28325905, 30654377, 31171837, 31621494, 31924656, 32393308, 33679701, 35255727, 35280993, 35334833 View all (8 more)
Inflammation	Inhibit	29771377
Inflammatory Bowel Diseases	Associate	27898738, 28263993
Job Syndrome	Associate	39229272
Keratoderma Palmoplantar	Associate	30326918
Kidney Calculi	Inhibit	37093310
Kidney Diseases	Associate	12110011
Kidney Neoplasms	Associate	11369790
Klinefelter Syndrome	Associate	36177809
Leiomyosarcoma	Associate	19443701
Leukemia	Associate	15388891, 2832442
Leukemia Lymphoma Adult T Cell	Associate	30541986
Leukemia Myeloid	Associate	1373742, 3495006
Leukemia Myeloid Acute	Associate	1698479, 2832442, 3264194, 3495006
Leukemia Myelomonocytic Chronic	Stimulate	30026572
Leukoencephalopathies	Associate	34652888
Lung Diseases Interstitial	Associate	31732480
Lung Neoplasms	Associate	29323162, 7506922
Lupus Erythematosus Systemic	Associate	25012167, 28325905, 33549023
Lupus Erythematosus Systemic	Stimulate	34239365
Lupus Nephritis	Associate	25012167
Lupus Nephritis	Stimulate	25012167
Lymphatic Metastasis	Associate	20593409, 24263966
Lymphoma B Cell	Inhibit	17640305
Lymphoma Primary Effusion	Associate	21792887
Macrophage Activation Syndrome	Associate	26681753
MASS syndrome	Associate	16407111
Melanoma	Associate	16278308
Melhem Fahl syndrome	Associate	39625198
Mental Disorders	Associate	34652888
Mesothelioma	Associate	24722292
Mesothelioma Malignant	Associate	2787682, 32581053
Multiple Organ Failure	Associate	34504502
Musculoskeletal Diseases	Stimulate	25012167
Myelodysplastic Syndromes	Associate	11122147
Myeloproliferative Disorders	Associate	2669997
Myocardial Infarction	Associate	17922812
Myotonic Disorders	Stimulate	18163995
Nasopharyngeal Carcinoma	Associate	26743272, 37479694
Necrosis	Associate	25886010
Negative rheumatoid factor polyarthritis	Associate	15020327
Neoplasm Invasiveness	Associate	24263966
Neoplasm Metastasis	Associate	11956031, 16904609, 20593409, 30203045, 31565097, 37097499, 37676642
Neoplasms	Associate	11369790, 11956031, 16133109, 16407111, 1912583, 19188147, 1993220, 20593409, 20644162, 21098336, 21895511, 22957741, 23233531, 24263966, 24342436 View all (25 more)
Neoplasms Cystic Mucinous and Serous	Associate	30580386
Nephritis	Associate	12110011
Nephrolithiasis	Associate	37093310
Neurodevelopmental Disorders	Associate	17192722
Neuroendocrine Tumors	Associate	36461910
Neuroinflammatory Diseases	Associate	23866312
Neuroma Acoustic	Associate	30580386, 38216553
Non alcoholic Fatty Liver Disease	Associate	34006921
Obesity	Associate	21895511
Odontogenic Cysts	Associate	31424999
Odontogenic Tumors	Associate	26508096
Osteitis Deformans	Associate	20436471, 21623375
Osteoarthritis	Stimulate	25854167
Osteoarthritis	Associate	29547667, 40165259
Osteoarthritis Knee	Associate	36529415
Osteoarthritis Knee	Stimulate	40211184
Osteochondritis	Stimulate	25854167
Osteofibrous Dysplasia	Associate	21983933
Osteolysis	Associate	20796300
Osteopetrosis	Associate	9311741
Osteoporosis	Associate	15176972, 21895511
Ovarian Neoplasms	Associate	1695482, 18708368, 2663797, 36757936, 7599064, 8605095
Ovarian Neoplasms	Stimulate	22909061
Pancreatic Neoplasms	Associate	10926834
Parkinson Disease	Associate	24593806, 37834363
Peeling Skin Syndrome	Associate	26970370
Plaque Atherosclerotic	Associate	9185509
Pre Eclampsia	Associate	26970370
Precancerous Conditions	Associate	26990868
Precancerous Conditions	Inhibit	37843275
Preeclamptic toxemia	Stimulate	26970370
Primary Myelofibrosis	Associate	2669997
Prostate Cancer Hereditary 7	Associate	28039167
Prostatitis	Associate	16278308
Pulmonary Disease Chronic Obstructive	Associate	36846109
Respiratory Distress Syndrome	Stimulate	34163488
Respiratory Tract Infections	Associate	31565097
Reticular dysgenesis	Associate	34908483
Rhegmatogenous Retinal Detachment Autosomal Dominant	Associate	32542038
Sarcopenia	Associate	39345889
Serositis	Stimulate	25012167
Soft Tissue Neoplasms	Associate	19846920
Status Asthmaticus	Associate	37249291
Still's Disease Adult Onset	Associate	32149159
Stomach Neoplasms	Associate	26945355, 29358859
Synovitis Pigmented Villonodular	Associate	16407111, 25854167
Synovitis Pigmented Villonodular	Stimulate	19188147, 36320082
Takayasu Arteritis	Associate	39817309
Testicular Germ Cell Tumor	Associate	24342436
Thrombosis	Stimulate	10072108
Thyroid Cancer Papillary	Associate	16203990
Tooth Erosion	Associate	20796300
Tooth Erosion	Stimulate	25854167
Tooth Resorption	Stimulate	18389210
Uremia	Stimulate	9067911
Urethral Neoplasms	Stimulate	16278308
Uterine Cervical Neoplasms	Associate	32356483
Vascular System Injuries	Stimulate	10072108
Ventricular Remodeling	Associate	28407719
Vitreoretinopathy Proliferative	Associate	32542038
Wounds and Injuries	Associate	38216553

CSF1 (colony stimulating factor 1)