Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	143471
Gene name	Proteasome 20S subunit alpha 8
Gene symbol	PSMA8
Synonyms (NCBI Gene)	PSMA7L
Chromosome	18
Chromosome location	18q11.2

Show/Hide all (18)

miRTarBase ID	miRNA	Experiments
MIRT1270062	hsa-miR-1305	CLIP-seq
MIRT1270063	hsa-miR-23a	CLIP-seq
MIRT1270064	hsa-miR-23b	CLIP-seq
MIRT1270065	hsa-miR-23c	CLIP-seq
MIRT1270066	hsa-miR-3145-3p	CLIP-seq
MIRT1270067	hsa-miR-329	CLIP-seq
MIRT1270068	hsa-miR-3613-3p	CLIP-seq
MIRT1270069	hsa-miR-362-3p	CLIP-seq
MIRT1270070	hsa-miR-3941	CLIP-seq
MIRT1270071	hsa-miR-412	CLIP-seq
MIRT1270072	hsa-miR-4330	CLIP-seq
MIRT1270073	hsa-miR-490-5p	CLIP-seq
MIRT1270074	hsa-miR-603	CLIP-seq
MIRT1270075	hsa-miR-607	CLIP-seq
MIRT1270076	hsa-miR-2054	CLIP-seq
MIRT1270077	hsa-miR-380	CLIP-seq
MIRT1270078	hsa-miR-4307	CLIP-seq
MIRT1270079	hsa-miR-4495	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005829	Component	Cytosol	IEA
GO:0005839	Component	Proteasome core complex	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0010498	Process	Proteasomal protein catabolic process	IEA
GO:0010498	Process	Proteasomal protein catabolic process	ISS
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051321	Process	Meiotic cell cycle	ISS
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0060631	Process	Regulation of meiosis I	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1990111	Component	Spermatoproteasome complex	IEA
GO:1990111	Component	Spermatoproteasome complex	ISS

MIM	HGNC	e!Ensembl
617841	22985	ENSG00000154611

Q8TAA3

Protein name

Proteasome subunit alpha-type 8 (Proteasome alpha 4 subunit) (Alpha4s) (Proteasome subunit alpha-type 7-like)

Protein function

Component of the spermatoproteasome, a proteasome specifically found in testis that promotes acetylation-dependent degradation of histones, thereby participating actively to the exchange of histones during spermatogenesis. The proteasome is a pr

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10584	Proteasome_A_N	5 → 27	Proteasome subunit A N-terminal signature	Family
PF00227	Proteasome	28 → 219	Proteasome subunit	Domain

Sequence

MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAVLTIFIGLTADARVVINRARVECQSHKLTVEDPVTVEYITRFIA
TLKQKYTQSNGRRPFGISALIVGFDDDGISRLYQTDPSGTYHAWKANAIGRSAKTVREFL
EKNYTEDAIASDSEAIKLAIKALLEVVQSGGKNIELAIIRRNQPLKMFSAKEVELYVTEI
EKEKEEAEKKKSKKSV

Sequence length

256

Interactions

View interactions

	KEGG		Reactome
	Proteasome Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Prion disease Pathways of neurodegeneration - multiple diseases		Activation of NF-kappaB in B cells Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Cross-presentation of soluble exogenous antigens (endosomes) SCF-beta-TrCP mediated degradation of Emi1 APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Vpu mediated degradation of CD4 Vif-mediated degradation of APOBEC3G Degradation of beta-catenin by the destruction complex Downstream TCR signaling Separation of Sister Chromatids FCERI mediated NF-kB activation Autodegradation of the E3 ubiquitin ligase COP1 Regulation of ornithine decarboxylase (ODC) ABC-family proteins mediated transport AUF1 (hnRNP D0) binds and destabilizes mRNA Asymmetric localization of PCP proteins Degradation of AXIN Degradation of DVL Hedgehog ligand biogenesis Hh mutants that don't undergo autocatalytic processing are degraded by ERAD Dectin-1 mediated noncanonical NF-kB signaling CLEC7A (Dectin-1) signaling Degradation of GLI1 by the proteasome GLI3 is processed to GLI3R by the proteasome Hedgehog 'on' state Regulation of RAS by GAPs TNFR2 non-canonical NF-kB pathway NIK-->noncanonical NF-kB signaling Defective CFTR causes cystic fibrosis MAPK6/MAPK4 signaling UCH proteinases Ub-specific processing proteases CDT1 association with the CDC6:ORC:origin complex Orc1 removal from chromatin CDK-mediated phosphorylation and removal of Cdc6 G2/M Checkpoints Ubiquitin Mediated Degradation of Phosphorylated Cdc25A Ubiquitin-dependent degradation of Cyclin D The role of GTSE1 in G2/M progression after G2 checkpoint FBXL7 down-regulates AURKA during mitotic entry and in early mitosis RUNX1 regulates transcription of genes involved in differentiation of HSCs Regulation of PTEN stability and activity Neddylation Interleukin-1 signaling Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Colorectal Neoplasms	Associate	29547645	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMA8 (proteasome 20S subunit alpha 8)