Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
143458
Gene name Gene Name - the full gene name approved by the HGNC.
Low density lipoprotein receptor class A domain containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LDLRAD3
Synonyms (NCBI Gene) Gene synonyms aliases
LRAD3
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p13
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT037641 hsa-miR-744-5p CLASH 23622248
MIRT1106744 hsa-miR-105 CLIP-seq
MIRT1106745 hsa-miR-106a CLIP-seq
MIRT1106746 hsa-miR-106b CLIP-seq
MIRT1106747 hsa-miR-1205 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001540 Function Amyloid-beta binding IEA
GO:0005515 Function Protein binding IPI 26854353
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0006898 Process Receptor-mediated endocytosis IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617986 27046 ENSG00000179241
Protein
UniProt ID Q86YD5
Protein name Low-density lipoprotein receptor class A domain-containing protein 3 (LDLR class A domain-containing protein 3)
Protein function May influence APP processing, resulting in a decrease in sAPP-alpha production and increased amyloidogenic P3 peptide production. May regulate ITCH and NEDD4 E3 ligase activity and degradation (PubMed:26854353). {ECO:0000250, ECO:0000269|PubMed:
PDB 7FFF , 7FFL , 7FFN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00057 Ldl_recept_a 27 64 Low-density lipoprotein receptor domain class A Repeat
PF00057 Ldl_recept_a 69 106 Low-density lipoprotein receptor domain class A Repeat
PF00057 Ldl_recept_a 111 147 Low-density lipoprotein receptor domain class A Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in brain, lung, skeletal muscle, and pancreas. Expressed at moderate levels in heart, placenta, and kidney but not detected in the liver. {ECO:0000269|PubMed:21795536}.
Sequence
MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSD
EKEC
PKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHC
KNGLCIDKSFICDGQNNCQDNSDEESC
ESSQEPGSGQVFVTSENQLVYYPSITYAIIGSS
VIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQ
YVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSA
NSASSQAASSLLSVEDTSHSPGQPGPQEGTAEPRDSEPSQGTEEV
Sequence length 345
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alopecia Areata Alopecia areata N/A N/A GWAS
Asthma Asthma N/A N/A GWAS
Ischemic Stroke Ischemic stroke N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anxiety Associate 35577822
Carcinoma Non Small Cell Lung Stimulate 32658600
Carcinoma Non Small Cell Lung Associate 36817452
Colorectal Neoplasms Associate 37587156
COVID 19 Associate 34431042
Infections Associate 34431042
Lymphatic Metastasis Stimulate 29307994
Motor Disorders Associate 35577822
Neoplasm Metastasis Associate 29307994
Neoplasms Associate 35035814, 35975639