Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	142
Gene name Gene Name - the full gene name approved by the HGNC.	Poly(ADP-ribose) polymerase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PARP1
Synonyms (NCBI Gene) Gene synonyms aliases	ADPRT, ADPRT 1, ADPRT1, ARTD1, PARP, PARP-1, PARS, PPOL, Poly-PARP, pADPRT-1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q42.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processe

Show/Hide all(572)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019791	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT030724	hsa-miR-21-5p	Microarray	18591254
MIRT052650	hsa-miR-223-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23757351
MIRT046137	hsa-miR-30b-5p	CLASH	23622248
MIRT046091	hsa-miR-125b-5p	CLASH	23622248
MIRT045879	hsa-miR-128-3p	CLASH	23622248
MIRT045417	hsa-miR-149-5p	CLASH	23622248
MIRT042808	hsa-miR-339-5p	CLASH	23622248
MIRT041920	hsa-miR-484	CLASH	23622248
MIRT041220	hsa-miR-193b-3p	CLASH	23622248
MIRT041220	hsa-miR-193b-3p	CLASH	23622248
MIRT039741	hsa-miR-615-3p	CLASH	23622248
MIRT039741	hsa-miR-615-3p	CLASH	23622248
MIRT038771	hsa-miR-93-3p	CLASH	23622248
MIRT037766	hsa-miR-874-3p	CLASH	23622248
MIRT036540	hsa-miR-1225-3p	CLASH	23622248
MIRT036020	hsa-miR-1301-3p	CLASH	23622248
MIRT437390	hsa-miR-708-5p	Flow, qRT-PCR, Western blot	23754151
MIRT573914	hsa-miR-4475	PAR-CLIP	20371350
MIRT573913	hsa-miR-3925-5p	PAR-CLIP	20371350
MIRT573912	hsa-miR-3123	PAR-CLIP	20371350
MIRT573910	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT573911	hsa-miR-1253	PAR-CLIP	20371350
MIRT573909	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT573908	hsa-miR-365a-5p	PAR-CLIP	20371350
MIRT573907	hsa-miR-365b-5p	PAR-CLIP	20371350
MIRT573906	hsa-miR-580-3p	PAR-CLIP	20371350
MIRT573905	hsa-miR-1303	PAR-CLIP	20371350
MIRT516569	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT516567	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT516566	hsa-miR-8073	PAR-CLIP	20371350
MIRT516564	hsa-miR-3128	PAR-CLIP	20371350
MIRT516565	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT516569	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT516567	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT516566	hsa-miR-8073	PAR-CLIP	20371350
MIRT516564	hsa-miR-3128	PAR-CLIP	20371350
MIRT516565	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT504285	hsa-miR-302e	PAR-CLIP	20371350
MIRT504284	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT504283	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT504281	hsa-miR-520b	PAR-CLIP	20371350
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT504278	hsa-miR-520e	PAR-CLIP	20371350
MIRT504277	hsa-miR-577	PAR-CLIP	20371350
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT504272	hsa-miR-3666	PAR-CLIP	20371350
MIRT504271	hsa-miR-4295	PAR-CLIP	20371350
MIRT504270	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT504269	hsa-miR-4696	PAR-CLIP	20371350
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT547211	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT547210	hsa-miR-129-1-3p	PAR-CLIP	21572407
MIRT547209	hsa-miR-129-2-3p	PAR-CLIP	21572407
MIRT547208	hsa-miR-4687-5p	PAR-CLIP	21572407
MIRT547207	hsa-miR-6779-3p	PAR-CLIP	21572407
MIRT547206	hsa-miR-3189-3p	PAR-CLIP	21572407
MIRT547205	hsa-miR-6077	PAR-CLIP	21572407
MIRT547204	hsa-miR-555	PAR-CLIP	21572407
MIRT547203	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT547202	hsa-miR-3529-5p	PAR-CLIP	21572407
MIRT547201	hsa-miR-379-5p	PAR-CLIP	21572407
MIRT547200	hsa-miR-4451	PAR-CLIP	21572407
MIRT547199	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT547198	hsa-miR-4775	PAR-CLIP	21572407
MIRT547197	hsa-miR-6079	PAR-CLIP	21572407
MIRT547196	hsa-miR-1225-5p	PAR-CLIP	21572407
MIRT547195	hsa-miR-1229-5p	PAR-CLIP	21572407
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT504285	hsa-miR-302e	PAR-CLIP	22012620
MIRT504284	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT504283	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT504281	hsa-miR-520b	PAR-CLIP	22012620
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT504278	hsa-miR-520e	PAR-CLIP	22012620
MIRT504277	hsa-miR-577	PAR-CLIP	22012620
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT504272	hsa-miR-3666	PAR-CLIP	22012620
MIRT504271	hsa-miR-4295	PAR-CLIP	22012620
MIRT504270	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT504269	hsa-miR-4696	PAR-CLIP	22012620
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	22012620
MIRT516569	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT516567	hsa-miR-221-5p	PAR-CLIP	23446348
MIRT516566	hsa-miR-8073	PAR-CLIP	23446348
MIRT516564	hsa-miR-3128	PAR-CLIP	23446348
MIRT516565	hsa-miR-31-5p	PAR-CLIP	23446348
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT504285	hsa-miR-302e	PAR-CLIP	23446348
MIRT504284	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT504283	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT504281	hsa-miR-520b	PAR-CLIP	23446348
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT504278	hsa-miR-520e	PAR-CLIP	23446348
MIRT504277	hsa-miR-577	PAR-CLIP	23446348
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT504272	hsa-miR-3666	PAR-CLIP	23446348
MIRT504271	hsa-miR-4295	PAR-CLIP	23446348
MIRT504270	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT504269	hsa-miR-4696	PAR-CLIP	23446348
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT504285	hsa-miR-302e	PAR-CLIP	23446348
MIRT504284	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT504283	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT504281	hsa-miR-520b	PAR-CLIP	23446348
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT504278	hsa-miR-520e	PAR-CLIP	23446348
MIRT504277	hsa-miR-577	PAR-CLIP	23446348
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT504272	hsa-miR-3666	PAR-CLIP	23446348
MIRT504271	hsa-miR-4295	PAR-CLIP	23446348
MIRT504270	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT504269	hsa-miR-4696	PAR-CLIP	23446348
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT731987	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28281524
MIRT731987	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28281524
MIRT731987	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28281524
MIRT731987	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	28281524
MIRT732378	hsa-miR-335-5p	Luciferase reporter assay, qRT-PCR, Western blot	27871924
MIRT732378	hsa-miR-335-5p	Luciferase reporter assay, qRT-PCR, Western blot	27871924
MIRT732467	hsa-miR-124-3p	Luciferase reporter assay, Western blotting	34131409
MIRT734287	hsa-miR-17-5p	Western blotting	32442343
MIRT732467	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	32641757
MIRT573914	hsa-miR-4475	PAR-CLIP	20371350
MIRT573913	hsa-miR-3925-5p	PAR-CLIP	20371350
MIRT573912	hsa-miR-3123	PAR-CLIP	20371350
MIRT573910	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT573911	hsa-miR-1253	PAR-CLIP	20371350
MIRT573909	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT573908	hsa-miR-365a-5p	PAR-CLIP	20371350
MIRT573907	hsa-miR-365b-5p	PAR-CLIP	20371350
MIRT573906	hsa-miR-580-3p	PAR-CLIP	20371350
MIRT573905	hsa-miR-1303	PAR-CLIP	20371350
MIRT516569	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT516567	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT516566	hsa-miR-8073	PAR-CLIP	20371350
MIRT516564	hsa-miR-3128	PAR-CLIP	20371350
MIRT516565	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT516569	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	20371350
MIRT516567	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT516566	hsa-miR-8073	PAR-CLIP	20371350
MIRT516564	hsa-miR-3128	PAR-CLIP	20371350
MIRT516565	hsa-miR-31-5p	PAR-CLIP	20371350
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	20371350
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT504285	hsa-miR-302e	PAR-CLIP	20371350
MIRT504284	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT504283	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT504281	hsa-miR-520b	PAR-CLIP	20371350
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT504278	hsa-miR-520e	PAR-CLIP	20371350
MIRT504277	hsa-miR-577	PAR-CLIP	20371350
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT504272	hsa-miR-3666	PAR-CLIP	20371350
MIRT504271	hsa-miR-4295	PAR-CLIP	20371350
MIRT504270	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT504269	hsa-miR-4696	PAR-CLIP	20371350
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	20371350
MIRT547211	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT547210	hsa-miR-129-1-3p	PAR-CLIP	21572407
MIRT547209	hsa-miR-129-2-3p	PAR-CLIP	21572407
MIRT547208	hsa-miR-4687-5p	PAR-CLIP	21572407
MIRT547207	hsa-miR-6779-3p	PAR-CLIP	21572407
MIRT547206	hsa-miR-3189-3p	PAR-CLIP	21572407
MIRT547205	hsa-miR-6077	PAR-CLIP	21572407
MIRT547204	hsa-miR-555	PAR-CLIP	21572407
MIRT547203	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT547202	hsa-miR-3529-5p	PAR-CLIP	21572407
MIRT547201	hsa-miR-379-5p	PAR-CLIP	21572407
MIRT547200	hsa-miR-4451	PAR-CLIP	21572407
MIRT547199	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT547198	hsa-miR-4775	PAR-CLIP	21572407
MIRT547197	hsa-miR-6079	PAR-CLIP	21572407
MIRT547196	hsa-miR-1225-5p	PAR-CLIP	21572407
MIRT547195	hsa-miR-1229-5p	PAR-CLIP	21572407
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT504285	hsa-miR-302e	PAR-CLIP	22012620
MIRT504284	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT504283	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT504281	hsa-miR-520b	PAR-CLIP	22012620
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT504278	hsa-miR-520e	PAR-CLIP	22012620
MIRT504277	hsa-miR-577	PAR-CLIP	22012620
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	22012620
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	22012620
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	22012620
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	22012620
MIRT504272	hsa-miR-3666	PAR-CLIP	22012620
MIRT504271	hsa-miR-4295	PAR-CLIP	22012620
MIRT504270	hsa-miR-454-3p	PAR-CLIP	22012620
MIRT504269	hsa-miR-4696	PAR-CLIP	22012620
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	22012620
MIRT516569	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT516568	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT516567	hsa-miR-221-5p	PAR-CLIP	23446348
MIRT516566	hsa-miR-8073	PAR-CLIP	23446348
MIRT516564	hsa-miR-3128	PAR-CLIP	23446348
MIRT516565	hsa-miR-31-5p	PAR-CLIP	23446348
MIRT516563	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT504285	hsa-miR-302e	PAR-CLIP	23446348
MIRT504284	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT504283	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT504281	hsa-miR-520b	PAR-CLIP	23446348
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT504278	hsa-miR-520e	PAR-CLIP	23446348
MIRT504277	hsa-miR-577	PAR-CLIP	23446348
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT504272	hsa-miR-3666	PAR-CLIP	23446348
MIRT504271	hsa-miR-4295	PAR-CLIP	23446348
MIRT504270	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT504269	hsa-miR-4696	PAR-CLIP	23446348
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT504292	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT504291	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT504290	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT504289	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT504288	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT504287	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT504286	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT504285	hsa-miR-302e	PAR-CLIP	23446348
MIRT504284	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT504283	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT504282	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT504281	hsa-miR-520b	PAR-CLIP	23446348
MIRT504280	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT504279	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT504278	hsa-miR-520e	PAR-CLIP	23446348
MIRT504277	hsa-miR-577	PAR-CLIP	23446348
MIRT504276	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT504275	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT504274	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT504273	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT504272	hsa-miR-3666	PAR-CLIP	23446348
MIRT504271	hsa-miR-4295	PAR-CLIP	23446348
MIRT504270	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT504269	hsa-miR-4696	PAR-CLIP	23446348
MIRT504268	hsa-miR-4799-5p	PAR-CLIP	23446348
MIRT755541	hsa-miR-181c-5p	Western blotting, qRT-PCR	36676955
MIRT732467	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	36448327
MIRT755814	hsa-miR-124-5p	Luciferase reporter assay, qRT-PCR	36448327
MIRT734287	hsa-miR-17-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	36246167
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT1214456	hsa-miR-298	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT1214458	hsa-miR-3121-3p	CLIP-seq
MIRT1214459	hsa-miR-3129-3p	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT1214461	hsa-miR-3190	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT1214472	hsa-miR-4453	CLIP-seq
MIRT1214473	hsa-miR-4538	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT1214480	hsa-miR-4762-3p	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214484	hsa-miR-518e	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT2061706	hsa-miR-134	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT1214456	hsa-miR-298	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT2061707	hsa-miR-3117-3p	CLIP-seq
MIRT2061708	hsa-miR-3118	CLIP-seq
MIRT2061709	hsa-miR-3164	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT2061710	hsa-miR-3169	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT2061711	hsa-miR-3613-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT2061712	hsa-miR-4452	CLIP-seq
MIRT1214472	hsa-miR-4453	CLIP-seq
MIRT2061713	hsa-miR-4455	CLIP-seq
MIRT1214473	hsa-miR-4538	CLIP-seq
MIRT2061714	hsa-miR-4638-5p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT2061715	hsa-miR-4759	CLIP-seq
MIRT2061716	hsa-miR-4760-3p	CLIP-seq
MIRT2061717	hsa-miR-485-3p	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214484	hsa-miR-518e	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT2061718	hsa-miR-548ae	CLIP-seq
MIRT2061719	hsa-miR-548aj	CLIP-seq
MIRT2061720	hsa-miR-548am	CLIP-seq
MIRT2061721	hsa-miR-548x	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT2061722	hsa-miR-587	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT2061706	hsa-miR-134	CLIP-seq
MIRT2290092	hsa-miR-200b	CLIP-seq
MIRT2290093	hsa-miR-200c	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT2290094	hsa-miR-216b	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT2290095	hsa-miR-223	CLIP-seq
MIRT1214456	hsa-miR-298	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT2061707	hsa-miR-3117-3p	CLIP-seq
MIRT2061708	hsa-miR-3118	CLIP-seq
MIRT2290096	hsa-miR-3124-3p	CLIP-seq
MIRT2290097	hsa-miR-3143	CLIP-seq
MIRT2061709	hsa-miR-3164	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT2061710	hsa-miR-3169	CLIP-seq
MIRT1214461	hsa-miR-3190	CLIP-seq
MIRT2290098	hsa-miR-335	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT2290099	hsa-miR-374c	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT2290100	hsa-miR-3925-3p	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT2290101	hsa-miR-429	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT2290102	hsa-miR-4328	CLIP-seq
MIRT2061712	hsa-miR-4452	CLIP-seq
MIRT1214472	hsa-miR-4453	CLIP-seq
MIRT2061713	hsa-miR-4455	CLIP-seq
MIRT1214473	hsa-miR-4538	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT2290103	hsa-miR-4684-5p	CLIP-seq
MIRT2290104	hsa-miR-4697-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT2290105	hsa-miR-4716-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT2061715	hsa-miR-4759	CLIP-seq
MIRT2061716	hsa-miR-4760-3p	CLIP-seq
MIRT1214480	hsa-miR-4762-3p	CLIP-seq
MIRT2290106	hsa-miR-4768-5p	CLIP-seq
MIRT2290107	hsa-miR-4804-3p	CLIP-seq
MIRT2061717	hsa-miR-485-3p	CLIP-seq
MIRT2290108	hsa-miR-498	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214484	hsa-miR-518e	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT2061722	hsa-miR-587	CLIP-seq
MIRT2290109	hsa-miR-655	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT2290110	hsa-miR-766	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT1214455	hsa-miR-219-1-3p	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT2061707	hsa-miR-3117-3p	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT2061710	hsa-miR-3169	CLIP-seq
MIRT1214461	hsa-miR-3190	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT1214472	hsa-miR-4453	CLIP-seq
MIRT1214473	hsa-miR-4538	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT2061715	hsa-miR-4759	CLIP-seq
MIRT1214480	hsa-miR-4762-3p	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214487	hsa-miR-571	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT2061722	hsa-miR-587	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq
MIRT1214452	hsa-miR-124	CLIP-seq
MIRT1214453	hsa-miR-125a-3p	CLIP-seq
MIRT1214454	hsa-miR-2110	CLIP-seq
MIRT1214457	hsa-miR-299-5p	CLIP-seq
MIRT1214460	hsa-miR-3166	CLIP-seq
MIRT1214461	hsa-miR-3190	CLIP-seq
MIRT1214462	hsa-miR-3607-3p	CLIP-seq
MIRT1214463	hsa-miR-3667-3p	CLIP-seq
MIRT1214464	hsa-miR-3686	CLIP-seq
MIRT1214465	hsa-miR-3714	CLIP-seq
MIRT1214466	hsa-miR-3910	CLIP-seq
MIRT1214467	hsa-miR-4271	CLIP-seq
MIRT1214468	hsa-miR-4292	CLIP-seq
MIRT1214469	hsa-miR-4303	CLIP-seq
MIRT1214470	hsa-miR-4308	CLIP-seq
MIRT1214471	hsa-miR-4321	CLIP-seq
MIRT1214474	hsa-miR-4649-3p	CLIP-seq
MIRT1214475	hsa-miR-4652-3p	CLIP-seq
MIRT1214476	hsa-miR-4667-5p	CLIP-seq
MIRT1214477	hsa-miR-4668-3p	CLIP-seq
MIRT1214478	hsa-miR-4700-5p	CLIP-seq
MIRT1214479	hsa-miR-4725-3p	CLIP-seq
MIRT1214480	hsa-miR-4762-3p	CLIP-seq
MIRT1214481	hsa-miR-500a	CLIP-seq
MIRT1214482	hsa-miR-501-5p	CLIP-seq
MIRT1214483	hsa-miR-506	CLIP-seq
MIRT1214485	hsa-miR-545	CLIP-seq
MIRT1214486	hsa-miR-552	CLIP-seq
MIRT1214488	hsa-miR-580	CLIP-seq
MIRT1214489	hsa-miR-660	CLIP-seq
MIRT1214490	hsa-miR-670	CLIP-seq
MIRT1214491	hsa-miR-876-3p	CLIP-seq
MIRT1214492	hsa-miR-891b	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
EP300	Unknown	17065349
ETS1	Activation	11973649;24448423
ETS1	Repression	10435618
YY1	Unknown	9367892

Show/Hide all(163)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15607977, 22464733
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS
GO:0000723	Process	Telomere maintenance	TAS	25749521
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	18417535, 26811421, 35597237
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0000785	Component	Chromatin	IDA	30675909, 34874266
GO:0000785	Component	Chromatin	IDA	35013556
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IDA	21233213
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	2513174
GO:0003682	Function	Chromatin binding	IDA	30675909, 34874266, 35013556
GO:0003684	Function	Damaged DNA binding	IDA	22683995, 26626479, 26626480, 27568560, 30675909, 32241924, 32358582, 37823600
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003824	Function	Catalytic activity	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IBA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IDA	7852410, 16107709, 17396150, 18055453, 19470756, 19764761, 20388712, 23275542, 26626479, 26626480, 28190768, 30104678, 32028527, 32241924, 32358582, 33186521, 33683197, 34732825, 34795260, 35219381
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IMP	22504299
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	2513174
GO:0005515	Function	Protein binding	IPI	7596430, 9518481, 11248244, 14596914, 14627987, 14734561, 15044383, 15555565, 16107709, 16490787, 17167422, 17396150, 18172500, 18971944, 19661379, 19666485, 19710015, 19779455, 20064938, 20098424, 20133863, 21266351, 21549307, 21575865, 21577210, 21799911, 22504299, 22863007, 23213
GO:0005634	Component	Nucleus	IDA	22464733, 27256882, 34102106, 35393539, 35460603
GO:0005634	Component	Nucleus	IDA	17177976, 22504299, 37823600
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	2513174
GO:0005635	Component	Nuclear envelope	IDA	9518481
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	19303849
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	9518481, 16107709
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	25378300
GO:0005829	Component	Cytosol	IDA	35460603
GO:0005829	Component	Cytosol	IEA
GO:0006281	Process	DNA repair	IDA	21211722, 30104678, 30675909, 32028527, 33186521, 34486521, 34874266
GO:0006281	Process	DNA repair	IDA	30104678, 30675909, 31796734, 32028527, 33186521, 34874266
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	10958667, 17396150
GO:0006302	Process	Double-strand break repair	IBA
GO:0006302	Process	Double-strand break repair	IDA	28190768, 32028527
GO:0006302	Process	Double-strand break repair	IDA	24906880, 27568560, 28190768, 32028527
GO:0006302	Process	Double-strand break repair	IMP	23230272
GO:0006366	Process	Transcription by RNA polymerase II	TAS	29849146
GO:0006366	Process	Transcription by RNA polymerase II	TAS	10944198
GO:0006915	Process	Apoptotic process	IDA	15565177
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IDA	32358582
GO:0006974	Process	DNA damage response	IDA	22683995, 32358582, 35013556, 35393539, 37823600
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	24550317
GO:0006974	Process	DNA damage response	IMP	24289924, 27067600, 27248496
GO:0007005	Process	Mitochondrion organization	IMP	25378300
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0008047	Function	Enzyme activator activity	IDA	25749521
GO:0008270	Function	Zinc ion binding	IDA	18055453, 21233213
GO:0008270	Function	Zinc ion binding	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016540	Process	Protein autoprocessing	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0019901	Function	Protein kinase binding	IPI	17177976
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IEA
GO:0030225	Process	Macrophage differentiation	TAS	18309324
GO:0030331	Function	Nuclear estrogen receptor binding	IEA
GO:0030592	Process	DNA ADP-ribosylation	IDA	27471034
GO:0030592	Process	DNA ADP-ribosylation	IEA
GO:0031491	Function	Nucleosome binding	IDA	15607977, 31848352
GO:0031491	Function	Nucleosome binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032042	Process	Mitochondrial DNA metabolic process	IMP	25378300
GO:0032786	Process	Positive regulation of DNA-templated transcription, elongation	IDA	27256882
GO:0032869	Process	Cellular response to insulin stimulus	IDA	19303849
GO:0032880	Process	Regulation of protein localization	IMP	24550317
GO:0032991	Component	Protein-containing complex	IDA	22504299, 25378300
GO:0032993	Component	Protein-DNA complex	IDA	22504299
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IEA
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IDA	27256882
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IDA	35393539
GO:0034599	Process	Cellular response to oxidative stress	IMP	25378300
GO:0034644	Process	Cellular response to UV	IMP	24289924
GO:0035861	Component	Site of double-strand break	IDA	29234005
GO:0035861	Component	Site of double-strand break	IDA	26344098, 27568560, 30356214
GO:0036211	Process	Protein modification process	IMP	25378300
GO:0042802	Function	Identical protein binding	IPI	14734561, 23481255
GO:0042803	Function	Protein homodimerization activity	IDA	22683995
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	22464733
GO:0043504	Process	Mitochondrial DNA repair	IMP	25378300
GO:0043596	Component	Nuclear replication fork	IDA	33412112
GO:0045087	Process	Innate immune response	IEA
GO:0045188	Process	Regulation of circadian sleep/wake cycle, non-REM sleep	ISS
GO:0045824	Process	Negative regulation of innate immune response	IDA	35460603
GO:0045824	Process	Negative regulation of innate immune response	IMP	32844745
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11112786
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046697	Process	Decidualization	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051287	Function	NAD binding	IEA
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IEA
GO:0060545	Process	Positive regulation of necroptotic process	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19303849
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	28190768
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	15674325, 19470756, 25043379, 28190768, 33186521
GO:0070213	Process	Protein auto-ADP-ribosylation	IDA	15607977, 20388712, 29234005, 30675909, 32358582, 34210965, 34625544
GO:0070412	Function	R-SMAD binding	IEA
GO:0071168	Process	Protein localization to chromatin	IDA	21211722, 34874266
GO:0071168	Process	Protein localization to chromatin	IDA	34874266
GO:0071294	Process	Cellular response to zinc ion	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071932	Process	Replication fork reversal	IDA	33412112
GO:0090734	Component	Site of DNA damage	IDA	22683995, 26626479, 26626480, 30104678, 30675909, 31796734, 32028527, 32241924, 32358582, 33186521, 34795260, 34874266
GO:0090734	Component	Site of DNA damage	IEA
GO:0090734	Component	Site of DNA damage	IMP	27248496
GO:0140294	Function	NAD DNA ADP-ribosyltransferase activity	IDA	27471034
GO:0140294	Function	NAD DNA ADP-ribosyltransferase activity	IEA
GO:0140537	Function	Transcription regulator activator activity	IEA
GO:0140805	Function	NAD+-protein-serine ADP-ribosyltransferase activity	IDA	28190768, 29234005, 32028527, 33186521, 33412112, 33589610, 33683197, 34210965, 34732825, 34795260, 34874266, 35393539
GO:0140805	Function	NAD+-protein-serine ADP-ribosyltransferase activity	IEA
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IDA	19764761, 25043379, 35460603
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IEA
GO:0140807	Function	NAD+-protein-glutamate ADP-ribosyltransferase activity	IDA	19764761, 27256882
GO:0140807	Function	NAD+-protein-glutamate ADP-ribosyltransferase activity	IEA
GO:0140808	Function	NAD+-protein-tyrosine ADP-ribosyltransferase activity	IDA	29954836, 30257210
GO:0140808	Function	NAD+-protein-tyrosine ADP-ribosyltransferase activity	IEA
GO:0140815	Function	NAD+-protein-histidine ADP-ribosyltransferase activity	IDA	35393539
GO:0140815	Function	NAD+-protein-histidine ADP-ribosyltransferase activity	IEA
GO:0140816	Function	NAD+-histone H2BS6 serine ADP-ribosyltransferase activity	IDA	34874266
GO:0140817	Function	NAD+-histone H3S10 serine ADP-ribosyltransferase activity	IDA	34874266
GO:0140822	Function	NAD+-histone H2BE35 glutamate ADP-ribosyltransferase activity	ISS
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IDA	21211722
GO:0160049	Process	Negative regulation of cGAS/STING signaling pathway	IDA	35460603
GO:0160239	Process	Transcription pausing by RNA polymerase II	IDA	27256882
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1903376	Process	Regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1904044	Process	Response to aldosterone	IEA
GO:1904178	Process	Negative regulation of adipose tissue development	ISS
GO:1904179	Process	Positive regulation of adipose tissue development	ISS
GO:1904357	Process	Negative regulation of telomere maintenance via telomere lengthening	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1904762	Process	Positive regulation of myofibroblast differentiation	IEA
GO:1905051	Process	Regulation of base-excision repair	IDA	34102106
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	26344098, 30356214
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990166	Process	Protein localization to site of double-strand break	IDA	35597237
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IDA	7852410, 19764761, 24906880, 25043379, 25533949, 26344098, 28190768, 31796734, 32028527, 33186521, 34049076, 34102106, 34625544
GO:1990966	Process	ATP generation from poly-ADP-D-ribose	IDA	27257257
GO:2001170	Process	Negative regulation of ATP biosynthetic process	IMP	24289924

MIM	HGNC	e!Ensembl
173870	270	ENSG00000143799

Protein

UniProt ID

P09874

Protein name

Poly [ADP-ribose] polymerase 1 (PARP-1) (EC 2.4.2.30) (ADP-ribosyltransferase diphtheria toxin-like 1) (ARTD1) (DNA ADP-ribosyltransferase PARP1) (EC 2.4.2.-) (NAD(+) ADP-ribosyltransferase 1) (ADPRT 1) (Poly[ADP-ribose] synthase 1) (Protein poly-ADP-ribo

Protein function

Poly-ADP-ribosyltransferase that mediates poly-ADP-ribosylation of proteins and plays a key role in DNA repair (PubMed:17177976, PubMed:18055453, PubMed:18172500, PubMed:19344625, PubMed:19661379, PubMed:20388712, PubMed:21680843, PubMed:2258226

PDB

1UK0 , 1UK1 , 1WOK , 2COK , 2CR9 , 2CS2 , 2DMJ , 2JVN , 2L30 , 2L31 , 2N8A , 2RCW , 2RD6 , 2RIQ , 3GJW , 3GN7 , 3L3L , 3L3M , 3OD8 , 3ODA , 3ODC , 3ODE , 4AV1 , 4DQY , 4GV7 , 4HHY , 4HHZ , 4L6S , 4OPX , 4OQA , 4OQB , 4PJT , 4R5W , 4R6E , 4RV6 , 4UND , 4UXB , 4XHU , 4ZZZ , 5A00 , 5DS3 , 5HA9 , 5KPN , 5KPO , 5KPP , 5KPQ , 5WRQ , 5WRY , 5WRZ , 5WS0 , 5WS1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00645	zf-PARP	12 → 89	Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region	Domain
PF00645	zf-PARP	116 → 199	Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region	Domain
PF08063	PADR1	280 → 331	PADR1 (NUC008) domain	Domain
PF00533	BRCT	385 → 462	BRCA1 C Terminus (BRCT) domain	Family
PF05406	WGR	553 → 633	WGR domain	Domain
PF02877	PARP_reg	663 → 794	Poly(ADP-ribose) polymerase, regulatory domain	Domain
PF00644	PARP	808 → 1007	Poly(ADP-ribose) polymerase catalytic domain	Family

Sequence

MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW

Sequence length

1014

Interactions

View interactions

	KEGG		Reactome
	Base excision repair NF-kappa B signaling pathway Apoptosis Necroptosis Diabetic cardiomyopathy		POLB-Dependent Long Patch Base Excision Repair Downregulation of SMAD2/3:SMAD4 transcriptional activity SUMOylation of DNA damage response and repair proteins HDR through MMEJ (alt-NHEJ) DNA Damage Recognition in GG-NER Formation of Incision Complex in GG-NER Dual Incision in GG-NER

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Hereditary Renal Carcinoma	Hereditary renal cell carcinoma	N/A	N/A	ClinVar
Melanoma	Melanoma	N/A	N/A	GWAS
Neurodevelopmental Disorders	neurodevelopmental disorder	N/A	N/A	GenCC
Uterine Fibroids	Uterine fibroids	N/A	N/A	GWAS

Show/Hide Text Mining Associations (291)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Achalasia Addisonianism Alacrimia syndrome	Associate	21138955, 36946269
Acute Kidney Injury	Associate	29238179
Adenocarcinoma	Associate	23757351, 25179837, 34531868
Adenocarcinoma of Lung	Associate	23951099, 27655641, 29667179, 31386689, 34285141, 34531868, 35029906
Adrenocortical Carcinoma	Associate	34531868, 35848940
Airway Obstruction	Associate	32757651
Alzheimer Disease	Associate	20486200, 27034851, 27234294, 28558704
Alzheimer Disease	Inhibit	31827497
Anemia Aplastic	Associate	38237741
Anophthalmia with pulmonary hypoplasia	Associate	37449843
Arrest of spermatogenesis	Associate	25106941
Arthritis Rheumatoid	Associate	12632415, 15743888, 27626929
Asthma	Stimulate	40634444
Astrocytoma	Associate	20423999, 28654422, 37924373
Ataxia Telangiectasia	Associate	33571423
Atherosclerosis	Associate	23027378, 23085506, 25793984, 32981917
Autoimmune Diseases	Associate	25865228, 26429911
Azoospermia	Associate	28853108
Biliary Tract Neoplasms	Associate	34352995
Bipolar Disorder	Associate	38190860
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	32705175
Bloom Syndrome	Associate	26181065, 28463527
Bovine Respiratory Disease Complex	Associate	30851349
Brain Injuries	Associate	19925161
Brain Injuries Traumatic	Associate	18506195, 19925161
Brain Ischemia	Associate	19087198
Brain Neoplasms	Associate	23691191, 28099939, 31609976
Breast Diseases	Associate	26183824, 35864202
Breast Neoplasms	Associate	10400681, 15456408, 16251802, 16827122, 17897439, 18305410, 18701435, 19060926, 19724676, 21422199, 21700777, 22032731, 22166496, 22240506, 22416063 View all (54 more)
Breast Neoplasms	Inhibit	21821012, 39955949
Breast Neoplasms	Stimulate	28031413, 33184404, 40022708
Bronchiolitis Obliterans Syndrome	Associate	20574454
Bulbo Spinal Atrophy X Linked	Associate	11335100
Calcinosis	Associate	32981917, 37679327
Cancer Pain	Associate	32844745
Cap Myopathy	Associate	23475579
Carcinogenesis	Associate	22412903, 25268610, 27656839, 28714367, 30183716, 31609976, 33112558, 36006023, 36991000, 39731187
Carcinoid Tumor	Associate	19765735
Carcinoma Hepatocellular	Associate	20000738, 21410269, 22223166, 24367566, 25066396, 25543761, 26883192, 28498459, 3029772, 32705218, 33485358, 34531868, 37160416, 37356603
Carcinoma Hepatocellular	Stimulate	28714367
Carcinoma in Situ	Associate	24292451
Carcinoma Intraductal Noninfiltrating	Associate	30786684
Carcinoma Merkel Cell	Associate	29570891
Carcinoma Neuroendocrine	Associate	32727929
Carcinoma Non Small Cell Lung	Associate	23275151, 23399959, 23428903, 23451039, 24761869, 26387143, 26617760, 30082520, 30589644, 31438892, 33284833, 34846107, 35018214, 36590386, 37441599
Carcinoma Ovarian Epithelial	Associate	21293287, 24413181, 27155850, 30880072, 32594311, 34071938, 36739964
Carcinoma Pancreatic Ductal	Associate	25590809, 28291774
Carcinoma Renal Cell	Inhibit	24595077
Carcinoma Renal Cell	Associate	28796254, 31081053, 32009115, 33741027, 34528699, 34531868, 36263616, 36999983
Carcinoma Small Cell	Associate	25374063, 31063862, 31125117
Carcinoma Squamous Cell	Associate	22269178, 22454210, 22624032, 34531868
Cardiac Output Low	Associate	33214570
Cardiomegaly	Associate	21422199
Cardiomyopathy Dilated	Associate	37462883
Cardiovascular Diseases	Associate	26091341, 32757651
Cerebral Infarction	Associate	36448327, 40702735
Cholangiocarcinoma	Associate	10209503, 32246704
Chondrosarcoma	Associate	34994649
Chondrosarcoma	Inhibit	39334838
Chordoma	Associate	27002766
Cockayne Syndrome	Associate	16107709
Cognition Disorders	Associate	31827497
Cognitive Dysfunction	Stimulate	27234294
Cognitive Dysfunction	Inhibit	31827497
Colitis Ulcerative	Inhibit	3146530
Colonic Diseases	Associate	22864776
Colonic Neoplasms	Associate	25526641, 27746584, 31199053, 34531868
Colorectal Neoplasms	Associate	21300766, 22194930, 22864776, 24870775, 25268610, 25526641, 26506418, 27197561, 27746584, 27902462, 28615517, 31199053, 31903985, 33076720, 33531658 View all (7 more)
Corneal Opacity	Associate	26990173
Coronary Artery Disease	Associate	32757651
COVID 19	Associate	32920092, 36499104, 37087842, 40513998
Crohn Disease	Inhibit	3146530
Cytokine Release Syndrome	Associate	23027378
Death	Associate	11756665, 18305410, 19087198, 21782324, 24843141, 27240523, 29045036, 33811702, 36946269, 37936170
Dementia Vascular	Associate	40624693
Dendritic Cell Sarcoma Follicular	Associate	27488020, 37994105
Diabetes Mellitus	Associate	19175688, 29238179
Diabetes Mellitus	Stimulate	36333113
Diabetes Mellitus Type 2	Associate	32757651
Diabetic Angiopathies	Associate	32757651
Diabetic Retinopathy	Stimulate	36333113
Diffuse Intrinsic Pontine Glioma	Associate	32229503
DNA Virus Infections	Associate	17225870, 21068357, 22387748, 23112151, 25690937, 29590171, 30598506, 31310591, 31391296, 31485297, 36640924, 37525239
DNA Virus Infections	Stimulate	26865334, 32630281
DNA Virus Infections	Inhibit	32079692
Drug Hypersensitivity	Inhibit	26505995
Drug Related Side Effects and Adverse Reactions	Associate	16521214, 17900801, 19732952, 20133863, 21470196, 22906755, 23152798, 23722590, 23913164, 25972196, 27064363, 27655641, 28103869, 28394191, 30080919 View all (4 more)
Drug Related Side Effects and Adverse Reactions	Inhibit	21912620, 24219164, 25061298, 26505995, 29511347, 29976574, 36243940, 36794257
Drug Related Side Effects and Adverse Reactions	Stimulate	26018559
Duodenal Neoplasms	Associate	36991000
Dysequilibrium syndrome	Associate	37052975
Dyskeratosis Congenita	Associate	12890806
Dyskeratosis Congenita	Stimulate	29055871
Dyslexia	Associate	18445785
Ectodermal Dysplasia	Associate	39424480
Ehrlichiosis	Associate	10772341
Emphysematous Cholecystitis	Associate	15684288
Endometrial Neoplasms	Stimulate	23762867
Endometrial Neoplasms	Associate	24625059, 28886696, 32360251, 34531868, 36006023, 36566215, 36946269
Ependymoma	Associate	22184287
Epidermal Nevus	Associate	25307738
Epstein Barr Virus Infections	Associate	29976663, 36286483, 37839162
Esophageal Neoplasms	Associate	33112558
Esophageal Squamous Cell Carcinoma	Associate	24033642, 24219164, 32374927, 33112558, 37838281
Exanthema	Associate	16412052
Fanconi Anemia	Associate	20068062
Fever	Associate	30115874
Fibrosis	Associate	36333113, 37462883
Genital Neoplasms Female	Associate	31771620
Glioblastoma	Associate	11772428, 19318434, 20532243, 22472897, 24593254, 25182801, 28099939, 28241425, 28656196, 32565597, 34531868, 37651725, 39273083, 39277626
Glioblastoma	Inhibit	19318434
Glioblastoma	Stimulate	28654422
Glioma	Associate	19124499, 21849329, 22184287, 23244082, 25273058, 27893811, 28202508, 28777431, 34531868, 35981653, 36809279, 37277492
Glioma of Brain Familial	Associate	34531868
Growth Disorders	Associate	11112786
Head and Neck Neoplasms	Associate	21719137, 21912620
Heart Diseases	Associate	17088946, 35147204
Heart Failure	Associate	17088946
Hemangioendothelioma Epithelioid	Associate	34994649
Hemangiosarcoma	Associate	34085099
Hemochromatosis	Associate	24184271
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	22869732, 22983061, 24841718
Hereditary Breast and Ovarian Cancer Syndrome	Associate	23656790, 24033642, 28754563, 32193285, 33525353, 33581682, 36941223, 39273190
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	36344544
Hyperglycemia	Stimulate	36333113
Hyperoxia	Stimulate	25831079
Hypertension	Stimulate	28660007
Hypoxia	Stimulate	17322376
Hypoxia	Inhibit	17600131
Hypoxia	Associate	25271986, 32296107, 33581682, 35409364, 36484652
Hypoxia Brain	Associate	33581682
Immunologic Deficiency Syndromes	Associate	28073364
Impotence Vasculogenic	Associate	36555812
Infections	Associate	36499104
Infertility Male	Associate	25106941
Inflammation	Associate	10939283, 11590148, 15304054, 18727057, 20421386, 21767974, 23027378, 23085506, 24829399, 24987732, 25793984, 25926140, 25972196, 26091341, 34982643, 36333113, 36624848, 37087842 View all (3 more)
Inflammation	Inhibit	29590171
Inflammation	Stimulate	33285109
Inflammatory Bowel Diseases	Associate	3146530
Inflammatory Breast Neoplasms	Associate	34445631
Intestinal Pseudo Obstruction	Associate	37002487
Ischemia	Associate	23763848
Ischemic Stroke	Associate	38020537
Kidney Diseases	Associate	34531868
Lead Poisoning Nervous System	Associate	32640694
Leiomyosarcoma	Associate	30541756, 31131495, 34301934, 37143137
Leukemia	Associate	11313278, 15142883, 19407318, 19671751, 20704577, 25390937, 26619102, 27064363, 31928132, 33924032, 35130631, 37358557, 37683650, 37967363
Leukemia B Cell	Stimulate	28983606
Leukemia Lymphocytic Chronic B Cell	Associate	15621735, 22120020, 24439051, 25161998, 26539646, 9129045, 9694730
Leukemia Lymphoma Adult T Cell	Associate	26497583, 35449091
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22517119, 22641215, 28631564
Leukemia Myeloid	Associate	19407318, 29967475
Leukemia Myeloid Acute	Associate	10233386, 18160664, 20557671, 22550344, 23349304, 25483710, 32423430, 33911178, 34207065, 34789078, 35130631, 37683650
Leukemia Myeloid Acute	Inhibit	15899912
Leukemia Myelomonocytic Acute	Associate	22550344
Leukemia Myelomonocytic Chronic	Inhibit	29797327
Leukemia Promyelocytic Acute	Associate	3106933, 34789078
Liposarcoma	Associate	31131495
Lung agenesis	Associate	23807292
Lung Neoplasms	Associate	17720873, 18612434, 21976407, 23275151, 23451039, 23591868, 23951099, 25179837, 26647102, 29072615, 29108454, 29306194, 31481733, 32859985, 33284833, 36006023, 36755223 View all (2 more)
Lupus Erythematosus Systemic	Associate	10207165, 27492607
Lymphoma	Associate	21956491, 28394191, 37329186
Lymphoma B Cell	Associate	24039967, 40707929
Lymphoma Large B Cell Diffuse	Associate	23960188, 29489886, 35322192
Lymphoma Mantle Cell	Associate	24841718
Lymphoma Non Hodgkin	Associate	10468853, 15988143, 20196871, 22184287, 22472897
Lymphoma Primary Effusion	Associate	17440103
Lymphoma T Cell	Associate	35014680
Macular Degeneration	Associate	34982643
Malformations of Cortical Development Group I	Associate	12867423, 14563674, 18782442, 25948110, 29070760, 8663484
Malnutrition	Associate	21818634
Medulloblastoma	Associate	22184287, 37783879
Melanoma	Associate	16084940, 16799643, 20837404, 21832879, 21983785, 22203954, 23537197, 24535833, 25837821, 26880244, 27476724, 28759004, 29074620, 31801187, 32380691 View all (7 more)
Melanoma Cutaneous Malignant	Associate	16084940, 18752052, 33572647, 34531868
Memory Disorders	Associate	31827497
Meningioma	Associate	25118896
Meningitis Bacterial	Associate	26316174
Mesothelioma	Associate	28090191
Mesothelioma Malignant	Associate	21289517, 21489980, 23301673, 28389374, 28756516, 32429658
Microsatellite Instability	Associate	21300766, 23349304
Mitochondrial complex I deficiency	Associate	27689878
Mitochondrial Diseases	Associate	21600017, 22198485, 22994717, 23409113, 23666923, 27689878, 29045036, 31276581, 38272357
Mitochondrial Diseases	Inhibit	29516570
Mouth Neoplasms	Associate	22882088, 24337492
Mouth Neoplasms	Stimulate	27827950
Mucopolysaccharidosis IV	Associate	37762422
Multiple Myeloma	Associate	11474117, 16487170, 22471522, 23913134, 29467487, 29969371, 31564190, 32079692, 35414773, 36861411, 37628771, 39736366, 39873160, 8434580
Mycosis Fungoides	Associate	33098490
Myelodysplastic Syndromes	Associate	18206726, 19407318
Myocardial Infarction	Associate	17225870
Myocardial Ischemia	Associate	17225870, 33811702
Nasopharyngeal Carcinoma	Associate	25872765, 26715277
Nausea	Associate	30080919
Necrosis	Associate	10373561, 17225870, 20421386, 22532167, 23666923, 23703322, 23722590, 23883585, 24441188, 24832602, 25161998, 26241492, 33811702
Necrosis	Stimulate	18305410
Necrosis	Inhibit	38593154
Neoplasm Metastasis	Associate	27643881, 31438892, 33184404, 33572647, 36484652
Neoplasm Metastasis	Stimulate	35651606
Neoplasms	Associate	10706869, 10946322, 15545229, 15621735, 16084940, 17214747, 18305405, 18356818, 18752052, 19553641, 19568233, 19671764, 19825992, 20049732, 20133863 View all (205 more)
Neoplasms	Stimulate	19823047, 22272282, 25526641, 31549216, 35848940
Neoplasms	Inhibit	21224467, 22315424, 33271982, 36990278, 39288655, 39334838
Neoplasms Glandular and Epithelial	Associate	24829399
Neoplasms Second Primary	Associate	21420246
Nerve Degeneration	Associate	24420784, 33443209, 37052975
Neuroblastoma	Associate	25563294, 27599694, 32103589, 35217496, 39731187
Neurocognitive Disorders	Associate	37002487
Neurodegenerative Diseases	Associate	24420784, 34750622
Neuroinflammatory Diseases	Associate	40624693
Neurologic Manifestations	Associate	17225870
Neuroma Acoustic	Associate	20150366
Neurotoxicity Syndromes	Associate	30850243
Neutropenia	Associate	19604089
NOG Related Symphalangism Spectrum Disorder	Associate	26323344
Obesity	Associate	32946760, 35417665
Oligospermia	Associate	25106941
Osteogenesis imperfecta type 3	Associate	29976663
Osteoglophonic dwarfism	Associate	35147204
Osteosarcoma	Associate	15670817, 27656839, 31433581
Ovarian Neoplasms	Associate	20606085, 21521830, 21613406, 22110186, 22180407, 22833573, 23442605, 23729402, 24097829, 24448423, 24554720, 24844596, 25509983, 25865228, 27141070 View all (51 more)
Ovarian Neoplasms	Inhibit	35444023, 35921524, 40117291
Ovarian Neoplasms	Stimulate	36344544
Pain	Associate	38002974
Pancreatic Neoplasms	Associate	11454803, 22134241, 22850545, 23722537, 25271986, 25333575, 25558828, 26247574, 28346693, 31856090, 32186702, 33214574, 33662100, 34531868, 34854226, 36113257, 38433576 View all (2 more)
Papillomavirus Infections	Associate	22454210
Parathyroid Neoplasms	Associate	36808802
Parkinson Disease	Associate	15672325
Penile Induration	Associate	25532569
Peripheral Arterial Disease	Associate	32755612
Peritonitis	Associate	37453150
Personality Disorders	Associate	21293287
Pheochromocytoma	Associate	34531868
Polyps	Stimulate	25526641
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	15142883, 15899912, 20533075, 21224467, 23753023, 26619102
Primary Ovarian Insufficiency	Associate	29367615
Progeria	Associate	24843141
Prostatic Neoplasms	Associate	20418896, 21045146, 22624032, 23565244, 23807292, 27426307, 28851861, 29500400, 31006810, 32123273, 32343890, 32427575, 32630281, 33176972, 33608381 View all (15 more)
Prostatic Neoplasms	Inhibit	28487881
Prostatic Neoplasms Castration Resistant	Associate	29261439, 34778690, 35701722, 36952634, 38049622
Prostatitis	Associate	18607066, 20196871, 23807292, 31125117
Pulmonary Disease Chronic Obstructive	Associate	23894640
Recombinant chromosome 8 syndrome	Associate	27141070, 28118040, 29467487, 30318511, 30686551, 34500047, 34667064, 35082299, 35384413, 35855837, 36053931, 36380518, 36694344, 36779660, 36794257 View all (4 more)
Recombinant chromosome 8 syndrome	Inhibit	27671334, 27908594, 31060523, 37160887
Rectal Neoplasms	Associate	20559012, 22864776, 25268610, 34531868
Reperfusion Injury	Associate	25197346
Retinoblastoma	Associate	34639028
Rhabdomyosarcoma	Associate	23913164
Rhabdomyosarcoma Alveolar	Associate	35879366
Rhabdomyosarcoma Embryonal	Associate	23913164
Sarcoma	Associate	21508354, 27643881, 31131495, 36779660, 36929572
Sarcoma Ewing	Associate	22460902, 26505995, 27336789, 29358035, 29513652, 31992690
Sarcoma Kaposi	Associate	22300411
Sarcoma Synovial	Associate	36849535
Schinzel Giedion syndrome	Associate	34193871
Severe Acute Respiratory Syndrome	Associate	19925161
Severe combined immunodeficiency due to adenosine deaminase deficiency	Inhibit	28463527
Sezary Syndrome	Associate	14632209
SHORT syndrome	Associate	39596510
Sjogren's Syndrome	Associate	37408182
Sleep Deprivation	Associate	11533241, 19700606
Sleep Deprivation	Stimulate	1618343
Small Cell Lung Carcinoma	Inhibit	22961666
Small Cell Lung Carcinoma	Associate	25400754, 29570891, 29906251, 31215481, 32767507, 36253561, 37390276, 37395033
Smith McCort Dysplasia	Associate	24843141
Spinal Cord Injuries	Associate	29255350
Squamous Cell Carcinoma of Head and Neck	Inhibit	17614107
Squamous Cell Carcinoma of Head and Neck	Associate	17614107, 22882088, 26799421, 27644669, 28257034, 30543656, 34531868, 36006023
Squamous Cell Carcinoma of Head and Neck	Stimulate	28415784
Stomach Neoplasms	Associate	21897022, 22901183, 24841718, 26540566, 28000850, 30066897, 31983162, 34531868, 37401238, 37889078
Stroke	Associate	11590148, 19087198, 36448327
Tertiary Lymphoid Structures	Associate	33572647
Testicular Germ Cell Tumor	Associate	34531868
Thymoma	Associate	34531868
Thyroid Cancer Papillary	Associate	28086241
Thyroid Neoplasms	Associate	28086241, 30183716, 36006023
Thyroiditis	Associate	30183716
Translocation Genetic	Associate	28066052
Triple Negative Breast Neoplasms	Associate	20632057, 22678161, 23717600, 23825533, 24420152, 25690937, 26083025, 26261599, 26703669, 27107440, 27472710, 27756336, 29064327, 30589644, 30725116 View all (11 more)
Triple Negative Breast Neoplasms	Inhibit	36990278
Upton Young syndrome	Associate	25307738
Urethral Neoplasms	Associate	30326563, 35737919
Urinary Bladder Neoplasms	Associate	22166496, 26873485, 27295004, 28433067, 29511347, 34531868, 39726319
Uterine Cervical Neoplasms	Associate	22454210, 22624032, 23633189, 25594147, 28993682, 34076351, 34531868, 34642300, 35503086
Uterine Cervical Neoplasms	Stimulate	33188153
Uveal melanoma	Associate	33572586, 34531868
Varicose Ulcer	Associate	30581533
Vascular Calcification	Associate	37679327
Venous Insufficiency	Associate	32141705
Werner Syndrome	Associate	14596914, 14612404, 15292449
Wounds and Injuries	Associate	35147204
Xeroderma Pigmentosum	Associate	23038248, 33495403
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Inhibit	24275069

PARP1 (poly(ADP-ribose) polymerase 1)