DCANP1 (dendritic cell associated nuclear protein 1)

Gene

• Entrez ID: 140947
• Gene name: Dendritic cell associated nuclear protein 1
• Gene symbol: DCANP1
• Synonyms (NCBI Gene): C5orf20, DCNP1
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: This intronless gene is specifically expressed in dendritic cells (DCs), which are potent antigen-presenting cells involved in activating naive T cells to initiate antigen-specific immune response. The encoded protein is localized mainly in the perinucleu

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0007356	Process	Thorax and anterior abdomen determination	IGI	23419067
GO:0016604	Component	Nuclear body	IDA
GO:0021559	Process	Trigeminal nerve development	IGI	23419067
GO:0021650	Process	Vestibulocochlear nerve formation	IGI	23419067
GO:0030432	Process	Peristalsis	IGI	23419067
GO:0031223	Process	Auditory behavior	IGI	23419067
GO:0035112	Process	Genitalia morphogenesis	IGI	23419067
GO:0042472	Process	Inner ear morphogenesis	IGI	23419067
GO:0048634	Process	Regulation of muscle organ development	IGI	23419067
GO:0048806	Process	Genitalia development	IGI	23419067
GO:0048839	Process	Inner ear development	IGI	23419067
GO:0050885	Process	Neuromuscular process controlling balance	IGI	23419067
GO:0071626	Process	Mastication	IGI	23419067
GO:0090102	Process	Cochlea development	IGI	23419067
GO:0090103	Process	Cochlea morphogenesis	IGI	23419067
GO:0097094	Process	Craniofacial suture morphogenesis	IGI	23419067
GO:0098583	Process	Learned vocalization behavior	IGI	23419067
GO:1901078	Process	Negative regulation of relaxation of muscle	IGI	23419067
GO:1905747	Process	Negative regulation of saliva secretion	IGI	23419067
GO:1905748	Process	Hard palate morphogenesis	IGI	23419067

Other IDs

• MIM: 609710
• HGNC: 24459
• e!Ensembl: ENSG00000251380

Protein

• UniProt ID: Q8TF63
• Protein name: Dendritic cell nuclear protein 1 (Dendritic cell nuclear protein-1) (Dendritic cell-associated nuclear protein)
• Protein function: Binds with and transactivates the corticotropin-releasing hormone (CRH) promoter.
• Tissue specificity: TISSUE SPECIFICITY: Expressed in neurons of the paraventricular nucleus, thalamus and occipital cortex and in glial cells (at protein level). Predominantly expressed in dendritic cells. Detected in brain and skeletal muscle. Highly expressed in mature den
• Sequence:

  MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPL
  QGLSEGLYPPGRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKT
  GQTRREGARKHLVCSFRLYPFTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKS
  SDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAA
  HVPE

• Sequence length: 244