Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
140947
Gene name Gene Name - the full gene name approved by the HGNC.
Dendritic cell associated nuclear protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DCANP1
Synonyms (NCBI Gene) Gene synonyms aliases
C5orf20, DCNP1
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This intronless gene is specifically expressed in dendritic cells (DCs), which are potent antigen-presenting cells involved in activating naive T cells to initiate antigen-specific immune response. The encoded protein is localized mainly in the perinucleu
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609710 24459 ENSG00000251380
Protein
UniProt ID Q8TF63
Protein name Dendritic cell nuclear protein 1 (Dendritic cell nuclear protein-1) (Dendritic cell-associated nuclear protein)
Protein function Binds with and transactivates the corticotropin-releasing hormone (CRH) promoter.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in neurons of the paraventricular nucleus, thalamus and occipital cortex and in glial cells (at protein level). Predominantly expressed in dendritic cells. Detected in brain and skeletal muscle. Highly expressed in mature den
Sequence
MHYGAATHIQNSRSHGLETVPGHQRLERGAGGETPEFPGCHSPAPPENFGNELLPLSAPL
QGLSEGLYPPGRNKTLPAGVLREGAVQFLHRGLCNSNLSSEASARPSGTQDELHSSRRKT
GQTRREGARKHLVCSFRLYPFTVHTVSPGNSHLALYQVFKAVKLCPSETSFFLSRKSLKS
SDPWHPPSLSPNSWNRQAGFRAWSSHLISLSLTCSDSQSRRVSSSQQPPLHSLSSHRRAA
HVPE
Sequence length 244
Interactions View interactions
<