R3HDML (R3H domain containing like)

Gene

• Entrez ID: 140902
• Gene name: R3H domain containing like
• Gene symbol: R3HDML
• Synonyms (NCBI Gene): dJ881L22.3
• Chromosome: 20
• Chromosome location: 20q13.12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017398	hsa-miR-335-5p	Microarray	18185580
MIRT1280626	hsa-miR-1207-3p	CLIP-seq
MIRT1280627	hsa-miR-1252	CLIP-seq
MIRT1280628	hsa-miR-1972	CLIP-seq
MIRT1280629	hsa-miR-3135b	CLIP-seq
MIRT1280630	hsa-miR-3173-3p	CLIP-seq
MIRT1280631	hsa-miR-3197	CLIP-seq
MIRT1280632	hsa-miR-3612	CLIP-seq
MIRT1280633	hsa-miR-3919	CLIP-seq
MIRT1280634	hsa-miR-4443	CLIP-seq
MIRT1280635	hsa-miR-4476	CLIP-seq
MIRT1280636	hsa-miR-4496	CLIP-seq
MIRT1280637	hsa-miR-4650-5p	CLIP-seq
MIRT1280638	hsa-miR-650	CLIP-seq
MIRT2082905	hsa-miR-150	CLIP-seq
MIRT2082906	hsa-miR-200b	CLIP-seq
MIRT2082907	hsa-miR-200c	CLIP-seq
MIRT2082908	hsa-miR-429	CLIP-seq
MIRT2308221	hsa-miR-1224-3p	CLIP-seq
MIRT2082905	hsa-miR-150	CLIP-seq
MIRT2082906	hsa-miR-200b	CLIP-seq
MIRT2082907	hsa-miR-200c	CLIP-seq
MIRT2082908	hsa-miR-429	CLIP-seq
MIRT2308222	hsa-miR-4716-5p	CLIP-seq
MIRT2308223	hsa-miR-4781-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0030414	Function	Peptidase inhibitor activity	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9H3Y0
• Protein name: Peptidase inhibitor R3HDML (Cysteine-rich secretory protein R3HDML)
• Protein function: Putative serine protease inhibitor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00188	CAP	67 → 207	Cysteine-rich secretory protein family	Domain

• Sequence:

  MPLLPSTVGLAGLLFWAGQAVNALIMPNATPAPAQPESTAMRLLSGLEVPRYRRKRHISV
  RDMNALLDYHNHIRASVYPPAANMEYMVWDKRLARAAEAWATQCIWAHGPSQLMRYVGQN
  LSIHSGQYRSVVDLMKSWSEEKWHYLFPAPRDCNPHCPWRCDGPTCSHYTQMVWASSNRL
  GCAIHTCSSISVWGNTWHRAAYLVCNYAIKGNWIGESPYKMGKPCSSCPPSYQGSCNSNM
  CFKGLKSNKFTWF

• Sequence length: 253

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Depressive Disorder	Associate	22220189	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	22220189	★★☆☆☆ Found in Text Mining + Unknown/Other Associations