Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1407
Gene name	Cryptochrome circadian regulator 1
Gene symbol	CRY1
Synonyms (NCBI Gene)	DSPDPHLL1
Chromosome	12
Chromosome location	12q23.3
Summary	This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulatio

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs184039278	T>C,G	Risk-factor	Missense variant, intron variant, coding sequence variant

Show/Hide all (39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043195	hsa-miR-324-5p	CLASH	23622248
MIRT911078	hsa-miR-299-5p	CLIP-seq
MIRT911079	hsa-miR-3120-5p	CLIP-seq
MIRT911080	hsa-miR-3152-3p	CLIP-seq
MIRT911081	hsa-miR-3973	CLIP-seq
MIRT911082	hsa-miR-499-3p	CLIP-seq
MIRT911083	hsa-miR-499a-3p	CLIP-seq
MIRT911084	hsa-miR-520g	CLIP-seq
MIRT911085	hsa-miR-520h	CLIP-seq
MIRT911086	hsa-miR-561	CLIP-seq
MIRT1970117	hsa-miR-3545-3p	CLIP-seq
MIRT1970118	hsa-miR-4286	CLIP-seq
MIRT1970119	hsa-miR-4680-5p	CLIP-seq
MIRT1970120	hsa-miR-548l	CLIP-seq
MIRT1970121	hsa-miR-548n	CLIP-seq
MIRT2206057	hsa-miR-193a-5p	CLIP-seq
MIRT911078	hsa-miR-299-5p	CLIP-seq
MIRT2206058	hsa-miR-3692	CLIP-seq
MIRT2386489	hsa-miR-1207-3p	CLIP-seq
MIRT2386490	hsa-miR-144	CLIP-seq
MIRT2206057	hsa-miR-193a-5p	CLIP-seq
MIRT2206058	hsa-miR-3692	CLIP-seq
MIRT2386491	hsa-miR-4709-5p	CLIP-seq
MIRT2386492	hsa-miR-4772-3p	CLIP-seq
MIRT2509223	hsa-miR-1284	CLIP-seq
MIRT2509224	hsa-miR-1323	CLIP-seq
MIRT2206057	hsa-miR-193a-5p	CLIP-seq
MIRT2509225	hsa-miR-3074-3p	CLIP-seq
MIRT2509226	hsa-miR-3613-3p	CLIP-seq
MIRT2509227	hsa-miR-361-5p	CLIP-seq
MIRT2509228	hsa-miR-4796-5p	CLIP-seq
MIRT2509229	hsa-miR-548o	CLIP-seq
MIRT2509230	hsa-miR-616	CLIP-seq
MIRT2509231	hsa-miR-617	CLIP-seq
MIRT2509224	hsa-miR-1323	CLIP-seq
MIRT2509225	hsa-miR-3074-3p	CLIP-seq
MIRT2509227	hsa-miR-361-5p	CLIP-seq
MIRT2509229	hsa-miR-548o	CLIP-seq
MIRT2509231	hsa-miR-617	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
ARNTL	Activation	22750052
ARNTL	Unknown	17660446
CLOCK	Activation	22750052
CLOCK	Unknown	17660446
NPAS2	Unknown	17660446

Show/Hide all (76)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12397359, 14672706, 15147242
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	TAS	9801304
GO:0003690	Function	Double-stranded DNA binding	IDA	9801304
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003904	Function	Deoxyribodipyrimidine photo-lyase activity	IDA	8909283
GO:0003914	Function	DNA (6-4) photolyase activity	IDA	8909283
GO:0005515	Function	Protein binding	IPI	9383998, 17463251, 20852621, 21613214, 21680841, 23133559, 26431207, 28514442, 30530698, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	26431207
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006094	Process	Gluconeogenesis	ISS
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0009416	Process	Response to light stimulus	IEA
GO:0009416	Process	Response to light stimulus	ISS
GO:0009785	Process	Blue light signaling pathway	NAS	8909283
GO:0009881	Function	Photoreceptor activity	IEA
GO:0009882	Function	Blue light photoreceptor activity	NAS	8909283
GO:0014823	Process	Response to activity	IEA
GO:0014823	Process	Response to activity	ISS
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	22170608
GO:0019900	Function	Kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019902	Function	Phosphatase binding	IEA
GO:0019902	Function	Phosphatase binding	IPI	9383998
GO:0019915	Process	Lipid storage	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	ISS
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0032922	Process	Circadian regulation of gene expression	IBA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033762	Process	Response to glucagon	IEA
GO:0033762	Process	Response to glucagon	ISS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042754	Process	Negative regulation of circadian rhythm	IEA
GO:0042754	Process	Negative regulation of circadian rhythm	ISS
GO:0042770	Process	Signal transduction in response to DNA damage	IEA
GO:0042770	Process	Signal transduction in response to DNA damage	ISS
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IBA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0045721	Process	Negative regulation of gluconeogenesis	IEA
GO:0045721	Process	Negative regulation of gluconeogenesis	ISS
GO:0045722	Process	Positive regulation of gluconeogenesis	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12397359, 23133559
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0070888	Function	E-box binding	IEA
GO:0071949	Function	FAD binding	IBA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:2000001	Process	Regulation of DNA damage checkpoint	IEA
GO:2000001	Process	Regulation of DNA damage checkpoint	ISS
GO:2000323	Process	Negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway	IEA
GO:2000323	Process	Negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway	ISS
GO:2000850	Process	Negative regulation of glucocorticoid secretion	IEA

MIM	HGNC	e!Ensembl
601933	2384	ENSG00000008405

Q16526

Protein name

Cryptochrome-1

Protein function

Transcriptional repressor which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in g

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00875	DNA_photolyase	5 → 170	DNA photolyase	Domain
PF03441	FAD_binding_7	286 → 486	FAD binding domain of DNA photolyase	Domain

Sequence

MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYA
HGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN

Sequence length

586

Interactions

View interactions

	KEGG
	Circadian rhythm

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	association; risk factor	rs184039278	RCV005899722
Attention deficit hyperactivity disorder	association; risk factor	rs780614131, rs184039278	RCV001849737 RCV001849384
Cervical cancer	association; risk factor	rs184039278	RCV005899726
Clear cell carcinoma of kidney	association; risk factor; Benign	rs184039278, rs112678362	RCV005899727 RCV005911786
Colon adenocarcinoma	association; risk factor	rs184039278	RCV005899721
Colorectal cancer	association; risk factor	rs184039278	RCV005899728
CRY1-related disorder	Uncertain significance; Likely benign; Benign	rs767156491, rs147009541, rs8192440, rs142529546, rs781745308, rs202236977, rs112678362, rs139335342	RCV003410435 RCV003974126 RCV003979800 RCV003909718 RCV003897376 RCV003914388 RCV003926181 RCV003923029
Delayed sleep phase syndrome, susceptibility to	Uncertain significance; association; risk factor	rs766372280, rs184039278	RCV004594921 RCV000490555
Familial cancer of breast	association; risk factor	rs184039278	RCV005899720
Gastric cancer	Uncertain significance; association; risk factor	rs201634474, rs184039278	RCV005929232 RCV005899730
Hepatocellular carcinoma	association; risk factor; Benign	rs184039278, rs112678362	RCV005899724 RCV005911784
Lung cancer	association; risk factor	rs184039278	RCV005899734
Malignant tumor of urinary bladder	association; risk factor	rs184039278	RCV005899723
Melanoma	association; risk factor	rs184039278	RCV005899733
Nonpapillary renal cell carcinoma	association; risk factor; Benign	rs184039278, rs112678362	RCV005899725 RCV005911785
Ovarian serous cystadenocarcinoma	association; risk factor; Benign	rs184039278, rs112678362	RCV005899731 RCV005911788
Sarcoma	association; risk factor; Benign	rs184039278, rs112678362	RCV005899729 RCV005911787
Sleep-wake schedule disorder, delayed phase type	association; risk factor	rs780614131, rs184039278	RCV001849737 RCV001849384
Thymoma	association; risk factor	rs184039278	RCV005899732
Thyroid cancer, nonmedullary, 1	Benign	rs112678362	RCV005911789
Uterine corpus endometrial carcinoma	association; risk factor	rs184039278	RCV005899735

Show/Hide Text Mining Associations (65)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma Mucinous	Inhibit	18720043
Adenocarcinoma of Lung	Associate	36385012
Anxiety	Associate	35365695, 38102312
Anxiety Disorders	Associate	35365695
Asthenozoospermia	Associate	35000095
Atherosclerosis	Associate	40441253
Attention Deficit and Disruptive Behavior Disorders	Inhibit	31708917
Attention Deficit Disorder with Hyperactivity	Associate	30758328, 32538895
Bipolar Disorder	Associate	21781277
Breast Neoplasms	Associate	29958276, 39193850
Carcinogenesis	Associate	34697063
Carcinoma Non Small Cell Lung	Associate	35575281
Carcinoma Ovarian Epithelial	Associate	18720043
Cardiovascular Diseases	Associate	34610814, 36324080, 37580741
Cell Transformation Neoplastic	Stimulate	33452241
Cluster Headache	Associate	34256648
Colonic Neoplasms	Stimulate	35116071
Colorectal Neoplasms	Associate	23626715, 26768731, 27492458
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	32538895
Depressive Disorder	Associate	20072116, 23138696, 33809270
Depressive Disorder Major	Associate	24581835
Diabetes Mellitus	Associate	24548145
Esophageal Neoplasms	Inhibit	32503923
Gastroesophageal Reflux	Associate	26337663
Glioblastoma	Associate	24135790
Glioma	Associate	23317246
Hearing Loss Noise Induced	Associate	34493277
Hearing Loss Sensorineural	Associate	26131842
Hypoxia	Associate	30235329
Infertility	Associate	35000095
Infertility Male	Associate	35000095
Insulin Resistance	Associate	24548145
Leukemia Biphenotypic Acute	Associate	22470559
Leukemia Lymphocytic Chronic B Cell	Associate	19181792, 22470559, 28572861, 28884705, 34187466
Leukemic Infiltration	Associate	28884705
Lung Neoplasms	Associate	35575281
Lymphatic Metastasis	Associate	23626715
Lymphoma Follicular	Inhibit	18720043
Lymphoma Large B Cell Diffuse	Associate	28731140
Mucopolysaccharidosis II	Associate	24083598
Neoplasm Metastasis	Associate	27492458
Neoplasms	Associate	18720043, 23626715, 26768731, 26927666, 31708917, 32503923, 33452241
Neoplasms	Inhibit	22081375
Obesity	Associate	31613643, 34610814, 36324080, 36497566, 37580741
Obesity Abdominal	Associate	35276838
Ovarian Neoplasms	Associate	18720043
Overweight	Associate	34610814, 36324080, 37580741
Pre Eclampsia	Stimulate	36284122
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	22470559
Prostatic Neoplasms	Associate	19934327, 21846818, 25388799, 33452241
Prostatitis	Associate	19934327
Pulmonary Disease Chronic Obstructive	Inhibit	25905433
Sleep Apnea Obstructive	Associate	30235329
Sleep Apnea Obstructive	Stimulate	39940739
Sleep Disorders Circadian Rhythm	Associate	28388406, 32538895
Sleep Initiation and Maintenance Disorders	Associate	32538895, 39201748
Sleep Wake Disorders	Associate	34924458, 36137075
Squamous Cell Carcinoma of Head and Neck	Inhibit	22081375
Stomach Neoplasms	Associate	24708606
Stomach Neoplasms	Stimulate	34162762
Stroke	Associate	32349365
Urinary Bladder Neoplasms	Associate	33650658
Uterine Cervical Neoplasms	Associate	34697063
Vertigo	Inhibit	26131842
Weight Loss	Stimulate	31613643

CRY1 (cryptochrome circadian regulator 1)