Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
140685
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger and BTB domain containing 46
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZBTB46
Synonyms (NCBI Gene) Gene synonyms aliases
BTBD4, BZEL, RINZF, ZNF340, dJ583P15.7, dJ583P15.8
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.33
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT724734 hsa-miR-6750-3p HITS-CLIP 19536157
MIRT724733 hsa-miR-3680-5p HITS-CLIP 19536157
MIRT533046 hsa-miR-6793-3p HITS-CLIP 19536157
MIRT724732 hsa-miR-361-3p HITS-CLIP 19536157
MIRT724731 hsa-miR-6889-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
GO:0000785 Component Chromatin ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614639 16094 ENSG00000130584
Protein
UniProt ID Q86UZ6
Protein name Zinc finger and BTB domain-containing protein 46 (BTB-ZF protein expressed in effector lymphocytes) (BZEL) (BTB/POZ domain-containing protein 4) (Zinc finger protein 340)
Protein function Functions as a transcriptional repressor for PRDM1.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 21 129 BTB/POZ domain Domain
PF13909 zf-H2C2_5 418 442 Domain
Sequence
MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLLGSSRYFKTLY
CQVQKTSEQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQA
CHDFIKAAL
DISIKSDASDELAEFEIGASSSSSTEALISAVMAGRSISPWLARRTSPANS
SGDSAIASCHDGGSSYGKEDQEPKADGPDDVSSQPLWPGDVGYGPLRIKEEQVSPSQYGG
SELPSAKDGAVQNSFSEQSAGDAWQPTGRRKNRKNKETVRHITQQVEDDSRASSPVPSFL
PTSGWPFSSRDSNADLSVTEASSSDSRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDA
LHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIRKKFKC
PYCSFSAMHQCILKRHMRSHTG
ERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCS
RVFMSAASVGIRHGSRRHGVCTDCAGRGMAGPLDHGGGGGEGSPEALFPGDGPYLEDPED
PRGEAEELGEDDEGLAPEDALLADDKDEEDSPRPRSPPGGPDKDFAWLS
Sequence length 589
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Diabetes Type 2 diabetes (adjusted for BMI), Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Coronary Disease Associate 24904205
Dendritic Cell Sarcoma Follicular Associate 29743654
Histiocytic Disorders Malignant Associate 29743654
Histiocytosis Langerhans Cell Associate 29743654
Influenza Human Associate 34276655
Lymphoma Large B Cell Diffuse Associate 29743654
Multiple Myeloma Inhibit 31164886
Multiple Sclerosis Associate 23739915
Neoplasms Squamous Cell Associate 29743654
Ovarian Neoplasms Associate 28893231