Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
140578
Gene name Gene Name - the full gene name approved by the HGNC.
Chondrolectin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CHODL
Synonyms (NCBI Gene) Gene synonyms aliases
C21orf68, MT75, PRED12
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathog
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT890958 hsa-miR-1224-5p CLIP-seq
MIRT890959 hsa-miR-1257 CLIP-seq
MIRT890960 hsa-miR-1304 CLIP-seq
MIRT890961 hsa-miR-3150b-3p CLIP-seq
MIRT890962 hsa-miR-3662 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005540 Function Hyaluronic acid binding IDA 12079284
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 22042635
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607247 17807 ENSG00000154645
Protein
UniProt ID Q9H9P2
Protein name Chondrolectin (Transmembrane protein MT75)
Protein function May play a role in the development of the nervous system such as in neurite outgrowth and elongation. May be involved in motor axon growth and guidance.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 50 180 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Found in spleen, testis, prostate and fetal liver. Expression limited to vascular muscle of testis, smooth muscle of prostate stroma, heart muscle, skeletal muscle, crypts of small intestine, and red pulp of spleen. B lymphocytes expre
Sequence
MSRVVSLLLGAALLCGHGAFCRRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLA
CESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQ
WSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKY

EPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPNLIYVVIPTIPLLLLILVAFGTCCF
QMLHKSKGRTKTSPNQSTLWISKSTRKESGMEV
Sequence length 273
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bulimia Bulimia nervosa N/A N/A GWAS
Rheumatic Heart Disease Rheumatic heart disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 33188687
Endometrial Neoplasms Associate 36581816