Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1401
Gene name Gene Name - the full gene name approved by the HGNC.	C-reactive protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CRP
Synonyms (NCBI Gene) Gene synonyms aliases	PTX1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q23.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the pentraxin family which also includes serum amyloid P component protein and pentraxin 3. Pentraxins are involved in complement activation and amplification via communication with complement initiation pattern

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT732532	hsa-miR-16-5p	Microarray	32041109
MIRT732623	hsa-miR-10b-5p	qRT-PCR	33787515
MIRT733299	hsa-miR-30a-3p	RNA-seq, qRT-PCR	33538126
MIRT733300	hsa-miR-192-3p	RNA-seq, qRT-PCR	33538126
MIRT733301	hsa-miR-146a-3p	RNA-seq, qRT-PCR	33538126
MIRT733302	hsa-miR-155-3p	RNA-seq, qRT-PCR	33538126
MIRT733303	hsa-miR-320a	RNA-seq, qRT-PCR	33538126
MIRT734910	hsa-miR-223-3p	qRT-PCR, ELISA	33238267
MIRT734911	hsa-miR-451a	qRT-PCR, ELISA	33238267
MIRT910539	hsa-miR-1288	CLIP-seq
MIRT910540	hsa-miR-2276	CLIP-seq
MIRT910541	hsa-miR-3126-5p	CLIP-seq
MIRT910542	hsa-miR-3199	CLIP-seq
MIRT910543	hsa-miR-3653	CLIP-seq
MIRT910544	hsa-miR-3658	CLIP-seq
MIRT910545	hsa-miR-4520a-5p	CLIP-seq
MIRT910546	hsa-miR-4520b-5p	CLIP-seq
MIRT910547	hsa-miR-4796-3p	CLIP-seq
MIRT910548	hsa-miR-539	CLIP-seq
MIRT910549	hsa-miR-580	CLIP-seq
MIRT2205930	hsa-miR-3661	CLIP-seq
MIRT2205931	hsa-miR-4433	CLIP-seq
MIRT2205932	hsa-miR-4459	CLIP-seq
MIRT2205933	hsa-miR-4768-3p	CLIP-seq
MIRT2205934	hsa-miR-631	CLIP-seq
MIRT2205935	hsa-miR-769-5p	CLIP-seq
MIRT2386481	hsa-miR-145	CLIP-seq

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
CEBPB	Activation	12667216;23361365
FOS	Unknown	18292576
HNF1A	Unknown	18292576;8703909
NFKB1	Activation	12667216;17704137
NFKB1	Unknown	17513780
REL	Unknown	18684932
RELA	Activation	12667216;17704137
RELA	Unknown	17513780
STAT3	Activation	12667216;20978825;23361365
STAT3	Unknown	18292576
TBP	Unknown	18684932

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001849	Function	Complement component C1q complex binding	IBA
GO:0001849	Function	Complement component C1q complex binding	IDA	23544079
GO:0001849	Function	Complement component C1q complex binding	IEA
GO:0005509	Function	Calcium ion binding	IDA	23544079
GO:0005515	Function	Protein binding	IPI	17244159, 17293598, 17339482, 17399790, 17785206, 18786923, 19084272, 19680263, 19850925, 20042240, 21037097, 21930971, 25416956, 26922829, 26984957, 28533443, 29374201
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	21323571, 23544079
GO:0006953	Process	Acute-phase response	IBA
GO:0006953	Process	Acute-phase response	IEA
GO:0006953	Process	Acute-phase response	TAS	2477488
GO:0006954	Process	Inflammatory response	TAS	10408362
GO:0008228	Process	Opsonization	TAS	2477488
GO:0010628	Process	Positive regulation of gene expression	IDA	24141169
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IDA	18322245
GO:0010888	Process	Negative regulation of lipid storage	IDA	18322245
GO:0030169	Function	Low-density lipoprotein particle binding	IBA
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	18322245
GO:0032677	Process	Regulation of interleukin-8 production	IDA	21037097
GO:0032930	Process	Positive regulation of superoxide anion generation	IDA	24141169
GO:0032945	Process	Negative regulation of mononuclear cell proliferation	IDA	29202702
GO:0033265	Function	Choline binding	TAS	2477488
GO:0042310	Process	Vasoconstriction	IDA	24141169
GO:0042310	Process	Vasoconstriction	IMP	24141169
GO:0042802	Function	Identical protein binding	IPI	16642000, 18786923, 19084272, 19680263, 19850925
GO:0045087	Process	Innate immune response	IBA
GO:0046790	Function	Virion binding	IDA	23544079
GO:0046872	Function	Metal ion binding	IEA
GO:0050750	Function	Low-density lipoprotein particle receptor binding	IPI	24141169
GO:0050830	Process	Defense response to Gram-positive bacterium	TAS	2477488

MIM	HGNC	e!Ensembl
123260	2367	ENSG00000132693

Protein

UniProt ID

P02741

Protein name

C-reactive protein [Cleaved into: C-reactive protein(1-205)]

Protein function

Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones

PDB

1B09 , 1GNH , 1LJ7 , 3L2Y , 3PVN , 3PVO , 7PK9 , 7PKB , 7PKD , 7PKE , 7PKF , 7PKG , 7PKH , 7TBA , 8WV4 , 8WV5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00354	Pentaxin	25 → 220	Pentaxin family	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in plasma.

Sequence

MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP

Sequence length

224

Interactions

View interactions

	Reactome
			Classical antibody-mediated complement activation

CRP (C-reactive protein)