Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	14
Gene name	Angio associated migratory cell protein
Gene symbol	AAMP
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2q35
Summary	The gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via t

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030529	hsa-miR-24-3p	Microarray	19748357
MIRT047035	hsa-miR-183-5p	CLASH	23622248
MIRT041563	hsa-miR-193b-3p	CLASH	23622248
MIRT038324	hsa-miR-130b-5p	CLASH	23622248
MIRT037106	hsa-miR-877-3p	CLASH	23622248
MIRT036525	hsa-miR-1226-3p	CLASH	23622248
MIRT757260	hsa-miR-1207-5p	CLIP-seq
MIRT757261	hsa-miR-1236	CLIP-seq
MIRT757262	hsa-miR-1909	CLIP-seq
MIRT757263	hsa-miR-24	CLIP-seq
MIRT757264	hsa-miR-3133	CLIP-seq
MIRT757265	hsa-miR-3153	CLIP-seq
MIRT757266	hsa-miR-3179	CLIP-seq
MIRT757267	hsa-miR-3202	CLIP-seq
MIRT757268	hsa-miR-329	CLIP-seq
MIRT757269	hsa-miR-342-3p	CLIP-seq
MIRT757270	hsa-miR-3609	CLIP-seq
MIRT757271	hsa-miR-361-3p	CLIP-seq
MIRT757272	hsa-miR-362-3p	CLIP-seq
MIRT757273	hsa-miR-3646	CLIP-seq
MIRT757274	hsa-miR-3675-3p	CLIP-seq
MIRT757275	hsa-miR-3692	CLIP-seq
MIRT757276	hsa-miR-371-5p	CLIP-seq
MIRT757277	hsa-miR-3923	CLIP-seq
MIRT757278	hsa-miR-3941	CLIP-seq
MIRT757279	hsa-miR-4284	CLIP-seq
MIRT757280	hsa-miR-4286	CLIP-seq
MIRT757281	hsa-miR-4311	CLIP-seq
MIRT757282	hsa-miR-4469	CLIP-seq
MIRT757283	hsa-miR-4668-3p	CLIP-seq
MIRT757284	hsa-miR-4681	CLIP-seq
MIRT757285	hsa-miR-4691-5p	CLIP-seq
MIRT757286	hsa-miR-4747-5p	CLIP-seq
MIRT757287	hsa-miR-4763-3p	CLIP-seq
MIRT757288	hsa-miR-486-3p	CLIP-seq
MIRT757289	hsa-miR-545	CLIP-seq
MIRT757290	hsa-miR-548ah	CLIP-seq
MIRT757291	hsa-miR-603	CLIP-seq
MIRT757292	hsa-miR-615-5p	CLIP-seq
MIRT757293	hsa-miR-642a	CLIP-seq
MIRT757261	hsa-miR-1236	CLIP-seq
MIRT757263	hsa-miR-24	CLIP-seq
MIRT757268	hsa-miR-329	CLIP-seq
MIRT757272	hsa-miR-362-3p	CLIP-seq
MIRT757278	hsa-miR-3941	CLIP-seq
MIRT757279	hsa-miR-4284	CLIP-seq
MIRT757281	hsa-miR-4311	CLIP-seq
MIRT757291	hsa-miR-603	CLIP-seq
MIRT757293	hsa-miR-642a	CLIP-seq
MIRT2164810	hsa-miR-1226	CLIP-seq
MIRT2164811	hsa-miR-1228	CLIP-seq
MIRT757261	hsa-miR-1236	CLIP-seq
MIRT2164812	hsa-miR-223	CLIP-seq
MIRT757263	hsa-miR-24	CLIP-seq
MIRT757265	hsa-miR-3153	CLIP-seq
MIRT757266	hsa-miR-3179	CLIP-seq
MIRT757267	hsa-miR-3202	CLIP-seq
MIRT757269	hsa-miR-342-3p	CLIP-seq
MIRT757270	hsa-miR-3609	CLIP-seq
MIRT757271	hsa-miR-361-3p	CLIP-seq
MIRT757273	hsa-miR-3646	CLIP-seq
MIRT757279	hsa-miR-4284	CLIP-seq
MIRT757280	hsa-miR-4286	CLIP-seq
MIRT757281	hsa-miR-4311	CLIP-seq
MIRT757282	hsa-miR-4469	CLIP-seq
MIRT2164813	hsa-miR-4685-5p	CLIP-seq
MIRT2164814	hsa-miR-4709-3p	CLIP-seq
MIRT757286	hsa-miR-4747-5p	CLIP-seq
MIRT2164815	hsa-miR-485-5p	CLIP-seq
MIRT757289	hsa-miR-545	CLIP-seq
MIRT757290	hsa-miR-548ah	CLIP-seq
MIRT2164816	hsa-miR-634	CLIP-seq
MIRT757293	hsa-miR-642a	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	NAS	10329261
GO:0005515	Function	Protein binding	IPI	28514442, 29892012, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0008201	Function	Heparin binding	IDA	7743515
GO:0009986	Component	Cell surface	IDA	10329261
GO:0010595	Process	Positive regulation of endothelial cell migration	ISS
GO:0014909	Process	Smooth muscle cell migration	IEP	18634987
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0045171	Component	Intercellular bridge	IDA

MIM	HGNC	e!Ensembl
603488	18	ENSG00000127837

Q13685

Protein name

Angio-associated migratory cell protein

Protein function

Plays a role in angiogenesis and cell migration. In smooth muscle cell migration, may act through the RhoA pathway.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	124 → 162	WD domain, G-beta repeat	Repeat
PF00400	WD40	208 → 243	WD domain, G-beta repeat	Repeat
PF00400	WD40	247 → 287	WD domain, G-beta repeat	Repeat
PF00400	WD40	348 → 386	WD domain, G-beta repeat	Repeat
PF00400	WD40	390 → 427	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in metastatic melanoma, liver, skin, kidney, heart, lung, lymph node, skeletal muscle and brain, and also in A2058 melanoma cells and activated T-cells (at protein level). Expressed in blood vessels. Strongly expressed in end

Sequence

MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEG
NEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWR
LSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWM
EWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIR
IWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRP
ETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSG
IVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG
DHKAKVFCVQRPDR

Sequence length

434

Interactions

View interactions

	Reactome
			NOD1/2 Signaling Pathway Signaling by EGFR Signaling by VEGF Thromboxane signalling through TP receptor

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SMOOTH SURFACE DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Inflammation	Associate	37122729	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	37122729	★★★★★ ★☆☆☆☆ Found in Text Mining only

AAMP (angio associated migratory cell protein)