Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1399
Gene name Gene Name - the full gene name approved by the HGNC.
CRK like proto-oncogene, adaptor protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CRKL
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kin
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004697 hsa-miR-107 Flow, Immunoblot, Microarray, qRT-PCR 19688090
MIRT006177 hsa-miR-15a-5p Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot 21880628
MIRT006177 hsa-miR-15a-5p Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot 21880628
MIRT006177 hsa-miR-15a-5p Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot 21880628
MIRT006177 hsa-miR-15a-5p Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot 21880628
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth IEA
GO:0001568 Process Blood vessel development IEA
GO:0001655 Process Urogenital system development IEA
GO:0001764 Process Neuron migration IEA
GO:0001783 Process B cell apoptotic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602007 2363 ENSG00000099942
Protein
UniProt ID P46109
Protein name Crk-like protein
Protein function May mediate the transduction of intracellular signals.
PDB 2BZX , 2BZY , 2DBK , 2EO3 , 2LQN , 2LQW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 14 88 SH2 domain Domain
PF00018 SH3_1 129 175 SH3 domain Domain
PF07653 SH3_2 239 294 Variant SH3 domain Domain
Sequence
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFY
KIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIF
DPQNPD
ENE
Sequence length 303
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
ErbB signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Efferocytosis
Focal adhesion
Fc gamma R-mediated phagocytosis
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Growth hormone synthesis, secretion and action
Bacterial invasion of epithelial cells
Shigellosis
Yersinia infection
Human cytomegalovirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
MicroRNAs in cancer
Renal cell carcinoma
Chronic myeloid leukemia
  Frs2-mediated activation
Downstream signal transduction
MET activates RAP1 and RAC1
MET receptor recycling
Erythropoietin activates RAS
Regulation of signaling by CBL
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer Patients with stage III colorectal cancer who received adjuvant 5-fluorouracil therapy had significantly worse survival when intratumoral CRKL expression was increased. 30480076 CBGDA
Congenital Heart Disease congenital heart disease N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
22q11 Deletion Syndrome Associate 22586683
Adenocarcinoma of Lung Associate 22586683, 23922113, 27078848
Adenocarcinoma Papillary Associate 25307974
Arthritis Rheumatoid Associate 20419126, 23339423
Bladder Exstrophy Associate 34355505
Blood Platelet Disorders Associate 11313252
Breast Neoplasms Associate 12006644, 23686806, 29155146
Breast Neoplasms Stimulate 26079153
Cakut Associate 34502088
Carcinogenesis Associate 19966867, 33523562