Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1394
Gene name Gene Name - the full gene name approved by the HGNC.	Corticotropin releasing hormone receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CRHR1
Synonyms (NCBI Gene) Gene synonyms aliases	CRF-R, CRF-R-1, CRF-R1, CRF1, CRFR-1, CRFR1, CRH-R-1, CRH-R1, CRHR, CRHR1L
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal tr

Show/Hide all(71)

miRTarBase ID	miRNA	Experiments
MIRT909538	hsa-miR-1202	CLIP-seq
MIRT909539	hsa-miR-1275	CLIP-seq
MIRT909540	hsa-miR-1343	CLIP-seq
MIRT909541	hsa-miR-148a	CLIP-seq
MIRT909542	hsa-miR-148b	CLIP-seq
MIRT909543	hsa-miR-152	CLIP-seq
MIRT909544	hsa-miR-3194-5p	CLIP-seq
MIRT909545	hsa-miR-3661	CLIP-seq
MIRT909546	hsa-miR-3945	CLIP-seq
MIRT909547	hsa-miR-3972	CLIP-seq
MIRT909548	hsa-miR-4253	CLIP-seq
MIRT909549	hsa-miR-4268	CLIP-seq
MIRT909550	hsa-miR-4448	CLIP-seq
MIRT909551	hsa-miR-4481	CLIP-seq
MIRT909552	hsa-miR-4525	CLIP-seq
MIRT909553	hsa-miR-4665-5p	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT909555	hsa-miR-4722-3p	CLIP-seq
MIRT909556	hsa-miR-4723-5p	CLIP-seq
MIRT909557	hsa-miR-4745-5p	CLIP-seq
MIRT909558	hsa-miR-625	CLIP-seq
MIRT909559	hsa-miR-631	CLIP-seq
MIRT909560	hsa-miR-637	CLIP-seq
MIRT909561	hsa-miR-3126-5p	CLIP-seq
MIRT909562	hsa-miR-432	CLIP-seq
MIRT909563	hsa-miR-4443	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT909538	hsa-miR-1202	CLIP-seq
MIRT909539	hsa-miR-1275	CLIP-seq
MIRT909540	hsa-miR-1343	CLIP-seq
MIRT909541	hsa-miR-148a	CLIP-seq
MIRT909542	hsa-miR-148b	CLIP-seq
MIRT909543	hsa-miR-152	CLIP-seq
MIRT909544	hsa-miR-3194-5p	CLIP-seq
MIRT909546	hsa-miR-3945	CLIP-seq
MIRT909547	hsa-miR-3972	CLIP-seq
MIRT909548	hsa-miR-4253	CLIP-seq
MIRT909549	hsa-miR-4268	CLIP-seq
MIRT909550	hsa-miR-4448	CLIP-seq
MIRT909551	hsa-miR-4481	CLIP-seq
MIRT909552	hsa-miR-4525	CLIP-seq
MIRT909553	hsa-miR-4665-5p	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT909556	hsa-miR-4723-5p	CLIP-seq
MIRT909557	hsa-miR-4745-5p	CLIP-seq
MIRT909558	hsa-miR-625	CLIP-seq
MIRT909560	hsa-miR-637	CLIP-seq
MIRT1969596	hsa-miR-1256	CLIP-seq
MIRT1969597	hsa-miR-138	CLIP-seq
MIRT1969598	hsa-miR-34a	CLIP-seq
MIRT1969599	hsa-miR-34c-5p	CLIP-seq
MIRT1969600	hsa-miR-4456	CLIP-seq
MIRT1969601	hsa-miR-449a	CLIP-seq
MIRT1969602	hsa-miR-449b	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT1969603	hsa-miR-4761-3p	CLIP-seq
MIRT2205741	hsa-miR-3189-5p	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT2205742	hsa-miR-4758-3p	CLIP-seq
MIRT2447620	hsa-miR-3125	CLIP-seq
MIRT2447621	hsa-miR-3689d	CLIP-seq
MIRT2447622	hsa-miR-3916	CLIP-seq
MIRT2447623	hsa-miR-4459	CLIP-seq
MIRT2447624	hsa-miR-4722-5p	CLIP-seq
MIRT2447625	hsa-miR-583	CLIP-seq
MIRT2508816	hsa-miR-1910	CLIP-seq
MIRT2508817	hsa-miR-3164	CLIP-seq
MIRT2508818	hsa-miR-486-5p	CLIP-seq
MIRT2508816	hsa-miR-1910	CLIP-seq
MIRT2508817	hsa-miR-3164	CLIP-seq
MIRT2508818	hsa-miR-486-5p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Activation	20233629
RELA	Activation	20233629

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18801728, 26352593, 30126976
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	10598591
GO:0006955	Process	Immune response	TAS	7692441
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	18292205
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	10598591
GO:0007565	Process	Female pregnancy	NAS	7585095
GO:0007567	Process	Parturition	TAS	10598591
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA	21873635
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0010578	Process	Regulation of adenylate cyclase activity involved in G protein-coupled receptor signaling pathway	IMP	23863939
GO:0015056	Function	Corticotrophin-releasing factor receptor activity	IBA	21873635
GO:0015056	Function	Corticotrophin-releasing factor receptor activity	IDA	18292205
GO:0016021	Component	Integral component of membrane	IDA	23863939
GO:0017046	Function	Peptide hormone binding	IBA	21873635
GO:0031226	Component	Intrinsic component of plasma membrane	IDA	18292205
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043404	Function	Corticotropin-releasing hormone receptor activity	IBA	21873635
GO:0051424	Function	Corticotropin-releasing hormone binding	IBA	21873635
GO:0051458	Process	Corticotropin secretion	ISS
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IDA	18292205
GO:1901386	Process	Negative regulation of voltage-gated calcium channel activity	IDA	18292205
GO:2000852	Process	Regulation of corticosterone secretion	ISS

MIM	HGNC	e!Ensembl
122561	2357	ENSG00000120088

Protein

UniProt ID

P34998

Protein name

Corticotropin-releasing factor receptor 1 (CRF-R-1) (CRF-R1) (CRFR-1) (Corticotropin-releasing hormone receptor 1) (CRH-R-1) (CRH-R1)

Protein function

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins)

PDB

2L27 , 3EHS , 3EHT , 3EHU , 4K5Y , 4Z9G , 6P9X , 6PB0 , 8GTG , 8GTI , 8GTM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02793	HRM	41 → 105	Hormone receptor domain	Family
PF00002	7tm_2	168 → 388	7 transmembrane receptor (Secretin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe. {ECO:0000269|PubMed:8243652}.

Sequence

MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV

Sequence length

444

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Long-term depression Cushing syndrome		Class B/2 (Secretin family receptors) G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	29915430
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	29915430
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	12631246
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	29915430
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	24842889, 22438815, 21738487

Show/Hide Unknown Diseases (6)

Disease term	Disease name	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder	24931706, 25422957, 24933348, 24867333, 25422958, 23962971, 23157339, 22249355, 22467522, 23529111	ClinVar
Neuroticism	Neuroticism		GWAS
Corticobasal Degeneration	Corticobasal Degeneration		GWAS
Schizophrenia	Schizophrenia		GWAS
Dementia	Dementia		GWAS
Hypertrophic cardiomyopathy	Hypertrophic cardiomyopathy		GWAS

Show/Hide Text Mining Associations (65)

Disease Name	Relationship Type	References
Associations from Text Mining
Abdominal Injuries	Associate	27497153
Abuse dwarfism syndrome	Associate	18250257
Alcoholism	Associate	20374216
Alzheimer Disease	Associate	37354922
Anxiety	Associate	18801728, 23274505, 26643280, 26923505, 31908177
Anxiety Disorders	Associate	19596121, 25059547, 26923505
Arthritis Psoriatic	Associate	22089831
Asthma	Associate	18622266, 19409562
Autism Spectrum Disorder	Associate	37907504
Axial osteomalacia	Associate	34602499
Breast Neoplasms	Associate	31908177
Bronchopulmonary Dysplasia	Associate	30467342
Chronic Urticaria	Associate	16297195
Colitis Ulcerative	Stimulate	22948128
Complex Regional Pain Syndromes	Associate	26940669
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Associate	25422957
Constipation	Associate	22957021
COVID 19	Associate	35482673
Crohn Disease	Stimulate	21383526
Cushing Syndrome	Associate	37543650
Cystitis Interstitial	Associate	31844086
Depressive Disorder	Associate	18250257, 18801728, 19220485, 19596121, 21438878, 22957021, 25059547, 26518448, 31908177, 32305063
Dermatitis Atopic	Associate	22360979
Diarrhea	Associate	22957021
Endometrial Neoplasms	Associate	19433256
Farber Lipogranulomatosis	Associate	31637879
Fatigue	Associate	31908177, 32305063
Fragile X Syndrome	Associate	22573456
Frontotemporal Dementia	Associate	27899424
Heart Failure	Associate	27754786
Inflammation	Associate	22948128, 23638035
Internal Hernia	Associate	25422957
Irritable Bowel Syndrome	Associate	22957021, 26808377, 27497153
Leukemia	Associate	22089831
Melanoma	Associate	10536983, 16245303
Mental Disorders	Associate	19220485, 23274505, 26518448
Neoplasms	Associate	10536983, 19433256, 28423358
Neurodermatitis	Associate	16297195
Neuroinflammatory Diseases	Associate	33803422
Obesity	Associate	34872017
Osteoarthritis Hip	Associate	37749624
Osteoarthritis Knee	Associate	37749624
Osteoporosis	Associate	22957024
Ovarian Neoplasms	Associate	17667919
Panic Disorder	Associate	23717480
Parkinson Disease	Associate	28586827
Pathophobia	Associate	23717480, 26643280
Pediatric Obesity	Associate	19596121, 30467342
Persistent Fetal Circulation Syndrome	Associate	22258127
Phobia Social	Associate	22573456
Polycystic Ovary Syndrome	Associate	37543650
Psoriasis	Associate	22360979
Pulmonary Disease Chronic Obstructive	Associate	19409562
Pulmonary Fibrosis	Inhibit	35482673
Signs and Symptoms Digestive	Associate	27497153
Sjogren's Syndrome	Associate	35896530
Sleep Wake Disorders	Associate	33725938
Spasm	Associate	27534449
Spasms Infantile	Stimulate	27534449
Stress Disorders Post Traumatic	Associate	24077033
Subarachnoid Hemorrhage	Associate	31959877, 32305063
Substance Related Disorders	Associate	21438878, 28793974
Trigeminal Neuralgia	Associate	38241377
Vascular Diseases	Associate	19409562
Vitiligo	Associate	35905107

CRHR1 (corticotropin releasing hormone receptor 1)