Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1393
Gene name Gene Name - the full gene name approved by the HGNC.	Corticotropin releasing hormone binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CRHBP
Synonyms (NCBI Gene) Gene synonyms aliases	CRF-BP, CRFBP
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidl

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002477	hsa-miR-16-5p	proteomics analysis	18362358
MIRT909527	hsa-miR-25	CLIP-seq
MIRT909528	hsa-miR-297	CLIP-seq
MIRT909529	hsa-miR-3149	CLIP-seq
MIRT909530	hsa-miR-32	CLIP-seq
MIRT909531	hsa-miR-363	CLIP-seq
MIRT909532	hsa-miR-367	CLIP-seq
MIRT909533	hsa-miR-4783-5p	CLIP-seq
MIRT909534	hsa-miR-567	CLIP-seq
MIRT909535	hsa-miR-92a	CLIP-seq
MIRT909536	hsa-miR-92b	CLIP-seq
MIRT909537	hsa-miR-933	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ESR1	Activation	15345745

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001963	Process	Synaptic transmission, dopaminergic	ISS
GO:0005515	Function	Protein binding	IPI	18234674
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	1846945, 18559919
GO:0005634	Component	Nucleus	ISS
GO:0005767	Component	Secondary lysosome	ISS
GO:0005771	Component	Multivesicular body	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	21624661
GO:0005794	Component	Golgi apparatus	IDA	21624661
GO:0005874	Component	Microtubule	ISS
GO:0006954	Process	Inflammatory response	IDA	18559919
GO:0007165	Process	Signal transduction	TAS	7477348
GO:0007565	Process	Female pregnancy	IDA	18559919
GO:0007565	Process	Female pregnancy	IEP	1846945
GO:0007611	Process	Learning or memory	TAS	7477348
GO:0009755	Process	Hormone-mediated signaling pathway	IBA	21873635
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	18234674
GO:0030141	Component	Secretory granule	IDA	21624661
GO:0030425	Component	Dendrite	ISS
GO:0031045	Component	Dense core granule	ISS
GO:0035690	Process	Cellular response to drug	ISS
GO:0035865	Process	Cellular response to potassium ion	IDA	21624661
GO:0042277	Function	Peptide binding	ISS
GO:0043196	Component	Varicosity	ISS
GO:0043204	Component	Perikaryon	ISS
GO:0043679	Component	Axon terminus	ISS
GO:0045055	Process	Regulated exocytosis	IDA	21624661
GO:0048149	Process	Behavioral response to ethanol	IMP	21039637
GO:0051424	Function	Corticotropin-releasing hormone binding	IBA	21873635
GO:0051424	Function	Corticotropin-releasing hormone binding	IDA	1846945
GO:0051424	Function	Corticotropin-releasing hormone binding	IPI	18234674
GO:0051459	Process	Regulation of corticotropin secretion	IDA	13150566
GO:0051460	Process	Negative regulation of corticotropin secretion	IBA	21873635
GO:0051460	Process	Negative regulation of corticotropin secretion	IDA	1846945
GO:0071277	Process	Cellular response to calcium ion	ISS
GO:0071314	Process	Cellular response to cocaine	ISS
GO:0071320	Process	Cellular response to cAMP	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	15345745
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	15345745
GO:0071392	Process	Cellular response to estradiol stimulus	IDA	15345745
GO:0080135	Process	Regulation of cellular response to stress	IMP	21039637
GO:0097211	Process	Cellular response to gonadotropin-releasing hormone	ISS
GO:1900011	Process	Negative regulation of corticotropin-releasing hormone receptor activity	IBA	21873635
GO:1900011	Process	Negative regulation of corticotropin-releasing hormone receptor activity	IDA	18234674
GO:2000310	Process	Regulation of NMDA receptor activity	ISS

MIM	HGNC	e!Ensembl
122559	2356	ENSG00000145708

Protein

UniProt ID

P24387

Protein name

Corticotropin-releasing factor-binding protein (CRF-BP) (CRF-binding protein) (Corticotropin-releasing hormone-binding protein) (CRH-BP)

Protein function

Binds CRF and inactivates it. May prevent inappropriate pituitary-adrenal stimulation in pregnancy.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05428	CRF-BP	1 → 307	Corticotropin-releasing factor binding protein (CRF-BP)	Family

Sequence

MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNL
FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGI
GDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQ
LEPYELENPNGNSIGEFCLSGL

Sequence length

322

Interactions

View interactions

	Reactome
			Class B/2 (Secretin family receptors)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder		17467808, 9118350, 20368512, 14573312	ClinVar

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Associate	26882083
Alcoholism	Associate	18974851
Anxiety	Associate	18974851
Anxiety Disorders	Associate	18974851
Breast Neoplasms	Associate	36788602
Carcinoma Hepatocellular	Associate	31277598
Carcinoma Renal Cell	Inhibit	23607589
Carcinoma Renal Cell	Associate	27695045
Infant Premature Diseases	Associate	36788602
Inflammation	Associate	35565057
Irritable Bowel Syndrome	Associate	26882083
Kidney Neoplasms	Inhibit	23607589
Kidney Neoplasms	Associate	27695045
Neoplasms	Associate	23607589, 27695045
Ovarian Diseases	Associate	31646556
Persistent Fetal Circulation Syndrome	Associate	22258127
Pre Eclampsia	Associate	23667551
Premature Birth	Associate	36788602
Prostatic Neoplasms	Associate	27695045
Vaginosis Bacterial	Associate	19131402

CRHBP (corticotropin releasing hormone binding protein)