Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1393
Gene name Gene Name - the full gene name approved by the HGNC.	Corticotropin releasing hormone binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CRHBP
Synonyms (NCBI Gene) Gene synonyms aliases	CRF-BP, CRFBP
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidl

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002477	hsa-miR-16-5p	proteomics analysis	18362358
MIRT909527	hsa-miR-25	CLIP-seq
MIRT909528	hsa-miR-297	CLIP-seq
MIRT909529	hsa-miR-3149	CLIP-seq
MIRT909530	hsa-miR-32	CLIP-seq
MIRT909531	hsa-miR-363	CLIP-seq
MIRT909532	hsa-miR-367	CLIP-seq
MIRT909533	hsa-miR-4783-5p	CLIP-seq
MIRT909534	hsa-miR-567	CLIP-seq
MIRT909535	hsa-miR-92a	CLIP-seq
MIRT909536	hsa-miR-92b	CLIP-seq
MIRT909537	hsa-miR-933	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
ESR1	Activation	15345745

Show/Hide all(57)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0001963	Process	Synaptic transmission, dopaminergic	ISS
GO:0002125	Process	Maternal aggressive behavior	IEA
GO:0005515	Function	Protein binding	IPI	18234674
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	1846945, 18559919
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005767	Component	Secondary lysosome	ISS
GO:0005771	Component	Multivesicular body	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	21624661
GO:0005794	Component	Golgi apparatus	IDA	21624661
GO:0005874	Component	Microtubule	ISS
GO:0006954	Process	Inflammatory response	IDA	18559919
GO:0007165	Process	Signal transduction	TAS	7477348
GO:0007565	Process	Female pregnancy	IDA	18559919
GO:0007565	Process	Female pregnancy	IEP	1846945
GO:0007611	Process	Learning or memory	TAS	7477348
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	18234674
GO:0030141	Component	Secretory granule	IDA	21624661
GO:0030425	Component	Dendrite	ISS
GO:0031045	Component	Dense core granule	ISS
GO:0035865	Process	Cellular response to potassium ion	IDA	21624661
GO:0042277	Function	Peptide binding	ISS
GO:0042445	Process	Hormone metabolic process	IEA
GO:0043196	Component	Varicosity	ISS
GO:0043204	Component	Perikaryon	ISS
GO:0043679	Component	Axon terminus	ISS
GO:0045055	Process	Regulated exocytosis	IDA	21624661
GO:0048149	Process	Behavioral response to ethanol	IMP	21039637
GO:0051424	Function	Corticotropin-releasing hormone binding	IBA
GO:0051424	Function	Corticotropin-releasing hormone binding	IDA	1846945
GO:0051424	Function	Corticotropin-releasing hormone binding	IEA
GO:0051424	Function	Corticotropin-releasing hormone binding	IPI	18234674
GO:0051459	Process	Regulation of corticotropin secretion	IDA	13150566
GO:0051460	Process	Negative regulation of corticotropin secretion	IBA
GO:0051460	Process	Negative regulation of corticotropin secretion	IDA	1846945
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0071277	Process	Cellular response to calcium ion	ISS
GO:0071314	Process	Cellular response to cocaine	ISS
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071320	Process	Cellular response to cAMP	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	15345745
GO:0071391	Process	Cellular response to estrogen stimulus	IDA	15345745
GO:0071392	Process	Cellular response to estradiol stimulus	IDA	15345745
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	ISS
GO:0080135	Process	Regulation of cellular response to stress	IMP	21039637
GO:0097211	Process	Cellular response to gonadotropin-releasing hormone	IEA
GO:0097211	Process	Cellular response to gonadotropin-releasing hormone	ISS
GO:1900011	Process	Negative regulation of corticotropin-releasing hormone receptor activity	IDA	18234674
GO:2000310	Process	Regulation of NMDA receptor activity	ISS

MIM	HGNC	e!Ensembl
122559	2356	ENSG00000145708

Protein

UniProt ID

P24387

Protein name

Corticotropin-releasing factor-binding protein (CRF-BP) (CRF-binding protein) (Corticotropin-releasing hormone-binding protein) (CRH-BP)

Protein function

Binds CRF and inactivates it. May prevent inappropriate pituitary-adrenal stimulation in pregnancy.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05428	CRF-BP	1 → 307	Corticotropin-releasing factor binding protein (CRF-BP)	Family

Sequence

MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNL
FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGI
GDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQ
LEPYELENPNGNSIGEFCLSGL

Sequence length

322

Interactions

View interactions

	Reactome
			Class B/2 (Secretin family receptors)

CRHBP (corticotropin releasing hormone binding protein)