Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1390
Gene name Gene Name - the full gene name approved by the HGNC.
CAMP responsive element modulator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CREM
Synonyms (NCBI Gene) Gene synonyms aliases
CREM-2, ICER, hCREM-2
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other comple
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT688650 hsa-miR-562 HITS-CLIP 23313552
MIRT688649 hsa-miR-4759 HITS-CLIP 23313552
MIRT688648 hsa-miR-3169 HITS-CLIP 23313552
MIRT688647 hsa-miR-8083 HITS-CLIP 23313552
MIRT688646 hsa-miR-4722-3p HITS-CLIP 23313552
Transcription factors
Transcription factor Regulation Reference
FOS Activation 21757709
JUN Activation 21757709
SP1 Activation 21757709
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 12626549
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 16899810
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
123812 2352 ENSG00000095794
Protein
UniProt ID Q03060
Protein name cAMP-responsive element modulator (Inducible cAMP early repressor) (ICER)
Protein function Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in sperm
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02173 pKID 98 140 pKID domain Family
PF00170 bZIP_1 284 344 bZIP transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in testes (round spermatids) (at protein level). Isoform 14 is the major activator form in testes. {ECO:0000269|PubMed:11044457, ECO:0000269|PubMed:14511788, ECO:0000269|PubMed:16143638}.
Sequence
MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQL
PSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPS
YRKILNELSSDVPGVPKIEE
ERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQI
SNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAP
SHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAA
KECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD
Y
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Adrenergic signaling in cardiomyocytes  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Dermatitis Dermatitis, Allergic Contact rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 17374397
Inflammatory bowel disease Inflammatory Bowel Diseases rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 26192919, 28067908
Psoriasis Psoriasis rs281875215, rs587777763, rs281875213, rs281875212 26974007
Unknown
Disease term Disease name Evidence References Source
Crohn disease Crohn Disease 26974007, 28067908 ClinVar
Myocardial infarction Myocardial Infarction 19027736 ClinVar
Crohn Disease Crohn Disease GWAS
Inflammatory Bowel Disease Inflammatory Bowel Disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Abdominal Neoplasms Associate 34228212
Brain Edema Associate 32970137
Breast Neoplasms Associate 27993161
Carcinoma Renal Cell Associate 34251595, 35165059
Central Nervous System Neoplasms Associate 28281318
Colitis Ulcerative Associate 23388545
Cystic Fibrosis Associate 35315363
Disease Associate 34261344
Ganglion Cysts Associate 28281318
Glioma Associate 36980858