Gene Gene information from NCBI Gene database.
Entrez ID 1390
Gene name CAMP responsive element modulator
Gene symbol CREM
Synonyms (NCBI Gene)
CREM-2ICERhCREM-2
Chromosome 10
Chromosome location 10p11.21
Summary This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other comple
miRNA miRNA information provided by mirtarbase database.
115
miRTarBase ID miRNA Experiments Reference
MIRT688650 hsa-miR-562 HITS-CLIP 23313552
MIRT688649 hsa-miR-4759 HITS-CLIP 23313552
MIRT688648 hsa-miR-3169 HITS-CLIP 23313552
MIRT688647 hsa-miR-8083 HITS-CLIP 23313552
MIRT688646 hsa-miR-4722-3p HITS-CLIP 23313552
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
FOS Activation 21757709
JUN Activation 21757709
SP1 Activation 21757709
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 12626549
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 16899810
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
123812 2352 ENSG00000095794
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q03060
Protein name cAMP-responsive element modulator (Inducible cAMP early repressor) (ICER)
Protein function Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in sperm
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02173 pKID 98 140 pKID domain Family
PF00170 bZIP_1 284 344 bZIP transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in testes (round spermatids) (at protein level). Isoform 14 is the major activator form in testes. {ECO:0000269|PubMed:11044457, ECO:0000269|PubMed:14511788, ECO:0000269|PubMed:16143638}.
Sequence
MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQL
PSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPS
YRKILNELSSDVPGVPKIEE
ERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQI
SNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAP
SHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAA
KECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD
Y
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Adrenergic signaling in cardiomyocytes