Gene Gene information from NCBI Gene database.
Entrez ID 1389
Gene name CAMP responsive element binding protein like 2
Gene symbol CREBL2
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12p13.1
Summary cAMP response element (CRE)-binding protein-like-2 (CREBL2) was identified in a search to find genes in a commonly deleted region on chromosome 12p13 flanked by ETV6 and CDKN1B genes, frequently associated with hematopoietic malignancies, as well as breas
miRNA miRNA information provided by mirtarbase database.
816
miRTarBase ID miRNA Experiments Reference
MIRT000833 hsa-miR-15a-5p Microarray 18362358
MIRT000832 hsa-miR-16-5p Microarray 18362358
MIRT024903 hsa-miR-215-5p Microarray 19074876
MIRT026935 hsa-miR-192-5p Microarray 19074876
MIRT031269 hsa-miR-19b-3p Sequencing 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
GO:0003700 Function DNA-binding transcription factor activity TAS 9693048
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603476 2350 ENSG00000111269
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60519
Protein name cAMP-responsive element-binding protein-like 2
Protein function Probable regulator of CREB1 transcriptional activity which is involved in adipose cells differentiation. May also play a regulatory role in the cell cycle. Identification in a chromosomal region frequently deleted in various cancers suggests tha
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2 24 75 Basic region leucine zipper Coiled-coil
Sequence
MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRER
AICALREELEMYKQW
CMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW
Sequence length 120
Interactions View interactions