Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1389
Gene name Gene Name - the full gene name approved by the HGNC.
CAMP responsive element binding protein like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CREBL2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
cAMP response element (CRE)-binding protein-like-2 (CREBL2) was identified in a search to find genes in a commonly deleted region on chromosome 12p13 flanked by ETV6 and CDKN1B genes, frequently associated with hematopoietic malignancies, as well as breas
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000833 hsa-miR-15a-5p Microarray 18362358
MIRT000832 hsa-miR-16-5p Microarray 18362358
MIRT024903 hsa-miR-215-5p Microarray 19074876
MIRT026935 hsa-miR-192-5p Microarray 19074876
MIRT031269 hsa-miR-19b-3p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
GO:0003700 Function DNA-binding transcription factor activity TAS 9693048
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603476 2350 ENSG00000111269
Protein
UniProt ID O60519
Protein name cAMP-responsive element-binding protein-like 2
Protein function Probable regulator of CREB1 transcriptional activity which is involved in adipose cells differentiation. May also play a regulatory role in the cell cycle. Identification in a chromosomal region frequently deleted in various cancers suggests tha
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2 24 75 Basic region leucine zipper Coiled-coil
Sequence
MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRER
AICALREELEMYKQW
CMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW
Sequence length 120
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS