Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1386
Gene name Gene Name - the full gene name approved by the HGNC.
Activating transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATF2
Synonyms (NCBI Gene) Gene synonyms aliases
CRE-BP1, CREB-2, CREB2, HB16, TREB7
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions This prote
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016080 hsa-miR-374b-5p Sequencing 20371350
MIRT019034 hsa-miR-335-5p Microarray 18185580
MIRT031029 hsa-miR-21-5p Microarray 18591254
MIRT031297 hsa-miR-19b-3p Sequencing 20371350
MIRT051336 hsa-miR-15a-5p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
DDIT3 Repression 16164412
NR3C1 Repression 17016446
RB1 Unknown 7702750
SP1 Unknown 2145272
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin IDA 23729669
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IMP 2516827
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
123811 784 ENSG00000115966
Protein
UniProt ID P15336
Protein name Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response el
Protein function Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequ
PDB 1BHI , 1T2K , 4H36 , 6ZQS , 6ZR5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 350 413 bZIP transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed, with more abundant expression in the brain.
Sequence
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLL
AHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
Sequence length 505
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
cGMP-PKG signaling pathway
PI3K-Akt signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Thermogenesis
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Thyroid hormone synthesis
Glucagon signaling pathway
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Cushing syndrome
Growth hormone synthesis, secretion and action
Prion disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Viral carcinogenesis
Chemical carcinogenesis - receptor activation
  Transcriptional activation of mitochondrial biogenesis
HATs acetylate histones
Circadian Clock
Activation of the AP-1 family of transcription factors
TP53 Regulates Transcription of DNA Repair Genes
Regulation of PTEN gene transcription
Estrogen-dependent gene expression
NGF-stimulated transcription
Response of EIF2AK4 (GCN2) to amino acid deficiency
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Unknown
Disease term Disease name Evidence References Source
Schizophrenia Schizophrenia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 29935546
Arteriovenous Fistula Associate 34987128
Arthritis Rheumatoid Associate 29577053
Atherosclerosis Associate 17244683
Autoimmune Diseases Associate 15185015
Bipolar Disorder Associate 18189280
Breast Neoplasms Associate 19331149, 26537518, 26729199, 27592113, 28618963
Breast Neoplasms Inhibit 33198803
Burkitt Lymphoma Associate 15185015
Carcinogenesis Associate 35394699, 35692887