Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	1386
Gene name	Activating transcription factor 2
Gene symbol	ATF2
Synonyms (NCBI Gene)	CRE-BP1CREB-2CREB2HB16TREB7
Chromosome	2
Chromosome location	2q31.1
Summary	This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions This prote

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016080	hsa-miR-374b-5p	Sequencing	20371350
MIRT019034	hsa-miR-335-5p	Microarray	18185580
MIRT031029	hsa-miR-21-5p	Microarray	18591254
MIRT031297	hsa-miR-19b-3p	Sequencing	20371350
MIRT051336	hsa-miR-15a-5p	CLASH	23622248
MIRT732803	hsa-miR-26b-5p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32476275
MIRT733466	hsa-miR-451a	Western blottingImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCR	32710569
MIRT804238	hsa-miR-1226	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT804242	hsa-miR-3591-3p	CLIP-seq
MIRT804243	hsa-miR-3609	CLIP-seq
MIRT804244	hsa-miR-3663-3p	CLIP-seq
MIRT804245	hsa-miR-3941	CLIP-seq
MIRT804246	hsa-miR-4477a	CLIP-seq
MIRT804247	hsa-miR-4643	CLIP-seq
MIRT804248	hsa-miR-466	CLIP-seq
MIRT804249	hsa-miR-4672	CLIP-seq
MIRT804250	hsa-miR-4729	CLIP-seq
MIRT804251	hsa-miR-4789-3p	CLIP-seq
MIRT804252	hsa-miR-545	CLIP-seq
MIRT804253	hsa-miR-548ah	CLIP-seq
MIRT804254	hsa-miR-548n	CLIP-seq
MIRT804255	hsa-miR-548t	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT804258	hsa-miR-634	CLIP-seq
MIRT804259	hsa-miR-802	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT1937507	hsa-miR-204	CLIP-seq
MIRT1937508	hsa-miR-211	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937510	hsa-miR-224	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937512	hsa-miR-3616-5p	CLIP-seq
MIRT1937513	hsa-miR-3647-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT1937515	hsa-miR-4446-5p	CLIP-seq
MIRT1937516	hsa-miR-4755-5p	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT2177152	hsa-miR-502-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT1937524	hsa-miR-573	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT1937525	hsa-miR-623	CLIP-seq
MIRT804239	hsa-miR-1303	CLIP-seq
MIRT804240	hsa-miR-221	CLIP-seq
MIRT804241	hsa-miR-222	CLIP-seq
MIRT1937517	hsa-miR-496	CLIP-seq
MIRT804256	hsa-miR-548v	CLIP-seq
MIRT804257	hsa-miR-622	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT2177150	hsa-miR-3124-3p	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2177151	hsa-miR-3663-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT2480442	hsa-miR-3688-3p	CLIP-seq
MIRT2480443	hsa-miR-4261	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT2480444	hsa-miR-4694-3p	CLIP-seq
MIRT2480445	hsa-miR-4738-3p	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT2480446	hsa-miR-522	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2177153	hsa-miR-582-3p	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq
MIRT2480440	hsa-miR-1205	CLIP-seq
MIRT1937509	hsa-miR-217	CLIP-seq
MIRT1937511	hsa-miR-3613-5p	CLIP-seq
MIRT2480441	hsa-miR-3665	CLIP-seq
MIRT1937514	hsa-miR-4418	CLIP-seq
MIRT1937518	hsa-miR-509-3-5p	CLIP-seq
MIRT1937519	hsa-miR-509-5p	CLIP-seq
MIRT1937520	hsa-miR-548a-3p	CLIP-seq
MIRT1937521	hsa-miR-548e	CLIP-seq
MIRT1937522	hsa-miR-548f	CLIP-seq
MIRT1937523	hsa-miR-548g	CLIP-seq
MIRT2480447	hsa-miR-657	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
DDIT3	Repression	16164412
NR3C1	Repression	17016446
RB1	Unknown	7702750
SP1	Unknown	2145272

109

Show/Hide all (109)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	EXP	11231009
GO:0000165	Process	MAPK cascade	IEA
GO:0000785	Component	Chromatin	IDA	23729669
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	2516827
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19861239
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IC	19861239
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	2196176
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16300731, 18671972, 19861239
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001865	Process	NK T cell differentiation	IEA
GO:0001889	Process	Liver development	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003360	Process	Brainstem development	IEA
GO:0003418	Process	Growth plate cartilage chondrocyte differentiation	IEA
GO:0003419	Process	Growth plate cartilage chondrocyte proliferation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	8798441
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004402	Function	Histone acetyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	8440710, 9748258, 10327051, 15105425, 15916964, 16511568, 18397884, 20102225, 20116378, 20195357, 20211142, 20511396, 22439931, 23661758, 24705354, 25416956, 25609649, 26496610, 28514442, 31515488, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	EXP	11231009
GO:0005634	Component	Nucleus	IDA	8798441, 18397884, 19861239, 21098032, 22304920
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758, 28186491
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	22304920
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	22304920
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	22304920
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	19861239
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758, 28186491
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006970	Process	Response to osmotic stress	IDA	21098032
GO:0006974	Process	DNA damage response	IDA	22304920
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	15916964
GO:0007033	Process	Vacuole organization	IEA
GO:0007254	Process	JNK cascade	IEA
GO:0007507	Process	Heart development	IEA
GO:0008140	Function	CAMP response element binding protein binding	IDA	19861239
GO:0008270	Function	Zinc ion binding	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010485	Function	Histone H4 acetyltransferase activity	IDA	10821277
GO:0010628	Process	Positive regulation of gene expression	IMP	28977001
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	28977001
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	17267404
GO:0019901	Function	Protein kinase binding	IPI	21098032
GO:0021742	Process	Abducens nucleus development	IEA
GO:0021743	Process	Hypoglossal nucleus development	IEA
GO:0021754	Process	Facial nucleus development	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0031573	Process	Mitotic intra-S DNA damage checkpoint signaling	IMP	15916964
GO:0032915	Process	Positive regulation of transforming growth factor beta2 production	IEA
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035497	Function	CAMP response element binding	IBA
GO:0035497	Function	CAMP response element binding	IDA	19861239, 23729669
GO:0035497	Function	CAMP response element binding	IEA
GO:0035861	Component	Site of double-strand break	IDA	15916964
GO:0035861	Component	Site of double-strand break	IEA
GO:0038066	Process	P38MAPK cascade	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042802	Function	Identical protein binding	IPI	16511568, 23661758
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0043522	Function	Leucine zipper domain binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044013	Function	Histone H2B acetyltransferase activity	IDA	10821277
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IDA	10821277
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16300731, 17267404, 18671972
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	10821277
GO:0060052	Process	Neurofilament cytoskeleton organization	IEA
GO:0060245	Process	Detection of cell density	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19861239
GO:0072740	Process	Cellular response to anisomycin	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	11231009
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758, 28186491
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097284	Process	Hepatocyte apoptotic process	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:0110024	Process	Positive regulation of cardiac muscle myoblast proliferation	IDA	22982025
GO:1902110	Process	Positive regulation of mitochondrial membrane permeability involved in apoptotic process	IMP	22304920
GO:1902562	Component	H4 histone acetyltransferase complex	IDA	10821277
GO:1902742	Process	Apoptotic process involved in development	IEA
GO:1990144	Process	Intrinsic apoptotic signaling pathway in response to hypoxia	IEA
GO:1990253	Process	Cellular response to leucine starvation	IDA	17267404
GO:1990253	Process	Cellular response to leucine starvation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990841	Function	Promoter-specific chromatin binding	IDA	17267404
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
123811	784	ENSG00000115966

P15336

Protein name

Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (cAMP response el

Protein function

Transcriptional activator which regulates the transcription of various genes, including those involved in anti-apoptosis, cell growth, and DNA damage response. Dependent on its binding partner, binds to CRE (cAMP response element) consensus sequ

PDB

1BHI , 1T2K , 4H36 , 6ZQS , 6ZR5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	350 → 413	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with more abundant expression in the brain.

Sequence

MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS

Sequence length

505

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway cGMP-PKG signaling pathway PI3K-Akt signaling pathway Longevity regulating pathway Adrenergic signaling in cardiomyocytes TNF signaling pathway Thermogenesis Dopaminergic synapse Insulin secretion Estrogen signaling pathway Thyroid hormone synthesis Glucagon signaling pathway Aldosterone synthesis and secretion Relaxin signaling pathway Cortisol synthesis and secretion Parathyroid hormone synthesis, secretion and action Cushing syndrome Growth hormone synthesis, secretion and action Prion disease Cocaine addiction Amphetamine addiction Alcoholism Hepatitis B Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Viral carcinogenesis Chemical carcinogenesis - receptor activation		Transcriptional activation of mitochondrial biogenesis HATs acetylate histones Circadian Clock Activation of the AP-1 family of transcription factors TP53 Regulates Transcription of DNA Repair Genes Regulation of PTEN gene transcription Estrogen-dependent gene expression NGF-stimulated transcription Response of EIF2AK4 (GCN2) to amino acid deficiency

ATF2 (activating transcription factor 2)