Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1385
Gene name Gene Name - the full gene name approved by the HGNC.
CAMP responsive element binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CREB1
Synonyms (NCBI Gene) Gene synonyms aliases
CREB, CREB-1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kin
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000066 hsa-miR-34b-5p Review, Luciferase reporter assay 19461653
MIRT004766 hsa-miR-103a-3p Luciferase reporter assay, qRT-PCR, Western blot 20886090
MIRT000066 hsa-miR-34b-5p Luciferase reporter assay, qRT-PCR, Western blot 19258499
MIRT006273 hsa-miR-182-5p GFP reporter assay 22325466
MIRT006273 hsa-miR-182-5p GFP reporter assay 22325466
Transcription factors
Transcription factor Regulation Reference
ATF5 Activation 17140605
CREBBP Activation 19564345
CREM Repression 11988318
FOXO4 Activation 20136501
SP1 Unknown 17937658
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000791 Component Euchromatin IDA 19861239
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 9065434, 19861239
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
123810 2345 ENSG00000118260
Protein
UniProt ID P16220
Protein name Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1)
Protein function Phosphorylation-dependent transcription factor that stimulates transcription upon binding to the DNA cAMP response element (CRE), a sequence present in many viral and cellular promoters (By similarity). Transcription activation is enhanced by th
PDB 2LXT , 5ZK1 , 5ZKO , 7TBH
Family and domains

Pfam


Warning: Undefined array key 339 in /var/www/html/new_GgeneT.php on line 1322
Accession ID Position in sequence Description Type
PF02173 pKID 113 153 pKID domain Family
PF00170 bZIP_1 281 340 bZIP transcription factor Coiled-coil
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITT
VTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
Sequence length 327
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  cGMP-PKG signaling pathway
cAMP signaling pathway
Efferocytosis
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Thermogenesis
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Insulin resistance
Cushing syndrome
Growth hormone synthesis, secretion and action
Vasopressin-regulated water reabsorption
Huntington disease
Prion disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Viral carcinogenesis
Chemical carcinogenesis - receptor activation
Prostate cancer
  AKT phosphorylates targets in the nucleus
CREB phosphorylation
Transcriptional activation of mitochondrial biogenesis
NCAM signaling for neurite out-growth
Circadian Clock
CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling
Constitutive Signaling by AKT1 E17K in Cancer
Gastrin-CREB signalling pathway via PKC and MAPK
NGF-stimulated transcription
HCMV Early Events
Estrogen-dependent nuclear events downstream of ESR-membrane signaling
ADORA2B mediated anti-inflammatory cytokines production
FCGR3A-mediated IL10 synthesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Melanoma Cutaneous Melanoma, Melanoma of soft tissue rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)
29179997
Sarcoma Clear Cell Sarcoma of Soft Tissue rs11540652, rs104886003, rs137852790, rs1555927374 19561568
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
10570922, 25043418, 22198373
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder 20643483, 21937024, 23619509, 22152193, 23269207, 25755794, 24006268, 24093582, 25059218, 23844928 ClinVar
Myocardial infarction Myocardial Infarction 19027736 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 25814225
Acute Disease Associate 11895805
Adenocarcinoma Associate 25382680
Adenocarcinoma of Lung Associate 33846793
Alcoholism Associate 36982708
Alzheimer Disease Associate 17908236, 20037212, 23168992, 23341039, 24436131, 27480489, 30080220, 32755048, 34556089, 36153426, 36982708, 39210294
Alzheimer Disease Inhibit 27480489, 37762325
Amyotrophic Lateral Sclerosis Associate 33692125
Aneuploidy Associate 16822311
Anxiety Associate 19194961, 20047710