RALYL (RALY RNA binding protein like)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
138046
Gene name Gene Name - the full gene name approved by the HGNC.
RALY RNA binding protein like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RALYL
Synonyms (NCBI Gene) Gene synonyms aliases
HNRPCL3
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q21.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT735412 hsa-miR-483-3p Western blotting, qRT-PCR 33219048
MIRT1289317 hsa-miR-208a CLIP-seq
MIRT1289318 hsa-miR-208b CLIP-seq
MIRT1289319 hsa-miR-23a CLIP-seq
MIRT1289320 hsa-miR-23b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674
GO:0003723 Function RNA binding IBA
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 19447967, 25416956, 25910212, 32296183, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
614648 27036 ENSG00000184672
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q86SE5
Protein name RNA-binding Raly-like protein (hRALYL) (Heterogeneous nuclear ribonucleoprotein C-like 3) (hnRNP core protein C-like 3)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 23 → 86 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest levels in brain. {ECO:0000269|PubMed:12688537}.
Sequence 
MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFV
QYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLS
VGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSR
STASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLV
LIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK
Sequence length 291
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Show/Hide Text Mining Associations (9)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 33298176, 40631452
Atrial Fibrillation Associate 37960721
Carcinoma Hepatocellular Associate 35765089
Carcinoma Renal Cell Associate 22994768
Colorectal Neoplasms Associate 35065650
Metabolic Syndrome Associate 26507551
Neoplasms Associate 22994768
Ovarian Neoplasms Inhibit 33437214
Small Cell Lung Carcinoma Associate 37399175