LETM2 (leucine zipper and EF-hand containing transmembrane protein 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
137994
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine zipper and EF-hand containing transmembrane protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LETM2
Synonyms (NCBI Gene) Gene synonyms aliases
SLC55A2
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p11.23
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(60)
miRTarBase ID miRNA Experiments Reference
MIRT716072 hsa-miR-4438 HITS-CLIP 19536157
MIRT716071 hsa-miR-455-5p HITS-CLIP 19536157
MIRT716070 hsa-miR-6504-3p HITS-CLIP 19536157
MIRT716069 hsa-miR-619-5p HITS-CLIP 19536157
MIRT716068 hsa-miR-6506-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0006851 Process Mitochondrial calcium ion transmembrane transport IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
620380 14648 ENSG00000165046
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q2VYF4
Protein name LETM1 domain-containing protein LETM2, mitochondrial (LETM1 and EF-hand domain-containing protein 2) (Leucine zipper-EF-hand-containing transmembrane protein 1-like)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07766 LETM1 122 → 386 LETM1-like protein Family
Sequence 
MAFYSYNSVLAIARTRFPSHFVHPTCSSYSPSCAFLHLPDSHLNKTCMKNYESKKYSDPS
QPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATKHPQVTSPQATKETGMEIKEGKQ
SYRQKIMDELKYYYNGFYLLWIDAKVAARMVWRLLHGQVLTRRERRRLLRTCVDFFRLVP
FMVFLIVPFMEFLLPVFLKLFPEMLPSTFESESKKEEKQKKKMAVKLELAKFLQETMTEM
ARRNRAKMGDASTQLSSYVKQVQTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKL
LELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEE
QLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFT
ESKENMVDLAPQLKGTKDEDFIQPPPVTSSPITPSTPISLPKGPITSSEEPTLQAKSQMT
AQNSKASSKGA
Sequence length 491
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 21666749
Carcinoma Squamous Cell Associate 21666749
Tuberculosis Associate 36476775