TMEM71 (transmembrane protein 71)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
137835
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 71
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM71
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.22
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT1439085 hsa-miR-3130-3p CLIP-seq
MIRT1439086 hsa-miR-586 CLIP-seq
MIRT1439087 hsa-miR-767-5p CLIP-seq
MIRT2131500 hsa-miR-3074-5p CLIP-seq
MIRT2131501 hsa-miR-3124-3p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
ING2 Unknown 20676127
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IDA
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
620287 26572 ENSG00000165071
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6P5X7
Protein name Transmembrane protein 71
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15121 TMEM71 1 → 150 TMEM71 protein family Family
Sequence 
MYRISQLMSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYT
CRRSPRLLTNGYYIWTEDSFLCDKDGNITLNPSQTSVMYKENLVRIFRKKKRICHSFSSL
FNLSTSKSWLHGSIFGDINSSPSEDNWLKGTRRLDTDHCNGNADDLDCSSLTDDWESGKM
NAESVITSSSSHIISQPPGGNSHSLSLQSQLTASERFQENSSDHSETRLLQEVFFQAILL
AVCLIISACARWFMGEILASVFTCSLMITVAYVKSLFLSLASYFKTTACARFVKI
Sequence length 295
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Hyperthyroidism Hyperthyroidism rs121908861, rs121908864, rs121908874, rs121908875, rs121908876, rs121908877, rs121908873, rs121908880, rs121908883, rs121909258, rs6256, rs869312167 30367059
Show/Hide Text Mining Associations (3)
Associations from Text Mining
Disease Name Relationship Type References
Glioblastoma Associate 31180187
Glioma Associate 31180187
Inflammation Associate 31180187