TMEM71 (transmembrane protein 71)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID 137835
Gene name Transmembrane protein 71
Gene symbol TMEM71
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8q24.22
miRNA miRNA information provided by mirtarbase database.
6
Gene miRNA Transcription factors Gene ontology Other IDs Protein
Show/Hide all (6)
miRTarBase ID miRNA Experiments Reference
MIRT1439085 hsa-miR-3130-3p CLIP-seq
MIRT1439086 hsa-miR-586 CLIP-seq
MIRT1439087 hsa-miR-767-5p CLIP-seq
MIRT2131500 hsa-miR-3074-5p CLIP-seq
MIRT2131501 hsa-miR-3124-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein
Show/Hide all (1)
Transcription factor Regulation Reference
ING2 Unknown 20676127
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein
Show/Hide all (3)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005739 Component Mitochondrion IDA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
620287 26572 ENSG00000165071
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6P5X7
Protein name Transmembrane protein 71
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15121 TMEM71 1 → 150 TMEM71 protein family Family
Sequence 
MYRISQLMSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYT
CRRSPRLLTNGYYIWTEDSFLCDKDGNITLNPSQTSVMYKENLVRIFRKKKRICHSFSSL
FNLSTSKSWLHGSIFGDINSSPSEDNWLKGTRRLDTDHCNGNADDLDCSSLTDDWESGKM
NAESVITSSSSHIISQPPGGNSHSLSLQSQLTASERFQENSSDHSETRLLQEVFFQAILL
AVCLIISACARWFMGEILASVFTCSLMITVAYVKSLFLSLASYFKTTACARFVKI
Sequence length 295
Interactions View interactions