Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
136647
Gene name Gene Name - the full gene name approved by the HGNC.
M-phase specific PLK1 interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MPLKIP
Synonyms (NCBI Gene) Gene synonyms aliases
ABHS, C7orf11, ORF20, TTD4
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p14.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene localizes to the centrosome during mitosis and to the midbody during cytokinesis. The protein is phosphorylated by cyclin-dependent kinase 1 during mitosis and subsequently interacts with polo-like kinase 1. The protein is
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT043354 hsa-miR-331-3p CLASH 23622248
MIRT723768 hsa-miR-548c-3p HITS-CLIP 19536157
MIRT723767 hsa-miR-4282 HITS-CLIP 19536157
MIRT723766 hsa-miR-3607-3p HITS-CLIP 19536157
MIRT723765 hsa-miR-8055 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17310276, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 17310276
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609188 16002 ENSG00000168303
Protein
UniProt ID Q8TAP9
Protein name M-phase-specific PLK1-interacting protein (TTD non-photosensitive 1 protein)
Protein function May play a role in maintenance of cell cycle integrity by regulating mitosis or cytokinesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15502 MPLKIP 94 179 M-phase-specific PLK1-interacting protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed at highest levels in liver and kidney; intermediate expression in skeletal muscle, pancreas, heart and placenta; low expression in brain and lung. Expressed in epidermis and hair follicles. {ECO:0000269|PubMed:11829489, ECO:0
Sequence
MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRP
YGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTST
PFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
Sequence length 179
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Trichothiodystrophy Trichothiodystrophy 4, nonphotosensitive, Trichothiodystrophy 1, photosensitive rs137853117, rs587776531, rs587776532, rs878854339, rs768342562, rs869312900 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cardiomyopathies Associate 26880286
Hypogonadism Associate 30598092
Infections Associate 34106579
Intellectual Disability Associate 15645389
Mitral Valve Insufficiency Associate 26880286
Trichothiodystrophy Syndromes Associate 15645389, 26880286, 30580289, 30598092, 37800682