Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1366
Gene name Gene Name - the full gene name approved by the HGNC.	Claudin 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CLDN7
Synonyms (NCBI Gene) Gene synonyms aliases	CEPTRL2, CLDN-7, CPETRL2, Hs.84359, claudin-1
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellula

Show/Hide all(73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017878	hsa-miR-335-5p	Microarray	18185580
MIRT042085	hsa-miR-484	CLASH	23622248
MIRT736372	hsa-miR-1193	Luciferase reporter assay, Western blotting, qRT-PCR	32547067
MIRT895523	hsa-miR-1183	CLIP-seq
MIRT895524	hsa-miR-1289	CLIP-seq
MIRT895525	hsa-miR-223	CLIP-seq
MIRT895526	hsa-miR-3198	CLIP-seq
MIRT895527	hsa-miR-323b-3p	CLIP-seq
MIRT895528	hsa-miR-342-5p	CLIP-seq
MIRT895529	hsa-miR-3545-3p	CLIP-seq
MIRT895530	hsa-miR-4255	CLIP-seq
MIRT895531	hsa-miR-4294	CLIP-seq
MIRT895532	hsa-miR-4309	CLIP-seq
MIRT895533	hsa-miR-4539	CLIP-seq
MIRT895534	hsa-miR-4639-5p	CLIP-seq
MIRT895535	hsa-miR-4651	CLIP-seq
MIRT895536	hsa-miR-4664-5p	CLIP-seq
MIRT895537	hsa-miR-4693-5p	CLIP-seq
MIRT895538	hsa-miR-4697-3p	CLIP-seq
MIRT895539	hsa-miR-556-3p	CLIP-seq
MIRT895540	hsa-miR-595	CLIP-seq
MIRT895541	hsa-miR-608	CLIP-seq
MIRT895523	hsa-miR-1183	CLIP-seq
MIRT895542	hsa-miR-1224-3p	CLIP-seq
MIRT895543	hsa-miR-1260	CLIP-seq
MIRT895544	hsa-miR-1260b	CLIP-seq
MIRT895545	hsa-miR-1280	CLIP-seq
MIRT895546	hsa-miR-150	CLIP-seq
MIRT895547	hsa-miR-2115	CLIP-seq
MIRT895548	hsa-miR-3148	CLIP-seq
MIRT895527	hsa-miR-323b-3p	CLIP-seq
MIRT895549	hsa-miR-3620	CLIP-seq
MIRT895550	hsa-miR-4269	CLIP-seq
MIRT895551	hsa-miR-4287	CLIP-seq
MIRT895552	hsa-miR-4305	CLIP-seq
MIRT895553	hsa-miR-4323	CLIP-seq
MIRT895554	hsa-miR-4469	CLIP-seq
MIRT895555	hsa-miR-4514	CLIP-seq
MIRT895556	hsa-miR-4639-3p	CLIP-seq
MIRT895557	hsa-miR-4668-5p	CLIP-seq
MIRT895558	hsa-miR-4685-3p	CLIP-seq
MIRT895559	hsa-miR-4690-3p	CLIP-seq
MIRT895560	hsa-miR-4692	CLIP-seq
MIRT895537	hsa-miR-4693-5p	CLIP-seq
MIRT895561	hsa-miR-4713-5p	CLIP-seq
MIRT895562	hsa-miR-4742-5p	CLIP-seq
MIRT895563	hsa-miR-516a-3p	CLIP-seq
MIRT895564	hsa-miR-532-3p	CLIP-seq
MIRT895565	hsa-miR-593	CLIP-seq
MIRT895566	hsa-miR-596	CLIP-seq
MIRT895567	hsa-miR-642a	CLIP-seq
MIRT895547	hsa-miR-2115	CLIP-seq
MIRT895548	hsa-miR-3148	CLIP-seq
MIRT1965518	hsa-miR-3179	CLIP-seq
MIRT895527	hsa-miR-323b-3p	CLIP-seq
MIRT895557	hsa-miR-4668-5p	CLIP-seq
MIRT895563	hsa-miR-516a-3p	CLIP-seq
MIRT895539	hsa-miR-556-3p	CLIP-seq
MIRT895566	hsa-miR-596	CLIP-seq
MIRT895535	hsa-miR-4651	CLIP-seq
MIRT895541	hsa-miR-608	CLIP-seq
MIRT895524	hsa-miR-1289	CLIP-seq
MIRT895526	hsa-miR-3198	CLIP-seq
MIRT895528	hsa-miR-342-5p	CLIP-seq
MIRT895530	hsa-miR-4255	CLIP-seq
MIRT895531	hsa-miR-4294	CLIP-seq
MIRT895532	hsa-miR-4309	CLIP-seq
MIRT895534	hsa-miR-4639-5p	CLIP-seq
MIRT895535	hsa-miR-4651	CLIP-seq
MIRT895536	hsa-miR-4664-5p	CLIP-seq
MIRT895538	hsa-miR-4697-3p	CLIP-seq
MIRT895540	hsa-miR-595	CLIP-seq
MIRT895541	hsa-miR-608	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
CTBP1	Repression	19277896
ELF3	Unknown	17060315
HDAC1	Activation	19277896
RUNX3	Activation	19706291

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	16054130, 20651236, 25416956, 32296183
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	20375010
GO:0005923	Component	Bicellular tight junction	IBA	21873635
GO:0005923	Component	Bicellular tight junction	ISS
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0007162	Process	Negative regulation of cell adhesion	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016327	Component	Apicolateral plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016338	Process	Calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS
GO:0019904	Function	Protein domain specific binding	IEA
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0050839	Function	Cell adhesion molecule binding	IEA
GO:0070830	Process	Bicellular tight junction assembly	IBA	21873635
GO:2000147	Process	Positive regulation of cell motility	IEA

MIM	HGNC	e!Ensembl
609131	2049	ENSG00000181885

Protein

UniProt ID

O95471

Protein name

Claudin-7 (CLDN-7)

Protein function

Plays a major role in tight junction-specific obliteration of the intercellular space.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00822	PMP22_Claudin	4 → 182	PMP-22/EMP/MP20/Claudin family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney, lung and prostate. Isoform 1 seems to be predominant, except in some normal prostate samples, where isoform 2 is the major form. Down-regulated in breast cancers, including ductal carcinoma in situ (DCIS), lobular

Sequence

MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG
MMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM
GGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGA
LLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

Sequence length

211

Interactions

View interactions

	KEGG
	Virion - Hepatitis viruses Cell adhesion molecules Tight junction Leukocyte transendothelial migration Pathogenic Escherichia coli infection Hepatitis C

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Show/Hide Text Mining Associations (79)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Inhibit	17585317
Adenocarcinoma	Associate	27687058
Adenoma	Associate	21310043
Adenoma Chromophobe	Associate	17449941
Adenoma Oxyphilic	Associate	15858144, 17449941
Adenomyosis	Associate	37019419
Ameloblastoma	Associate	31473941
Biliary Tract Neoplasms	Associate	18854598
Breast Neoplasms	Associate	19277896, 20103682, 21883696, 26919310, 36412442, 36691073, 39175074
Breast Neoplasms	Stimulate	33714203
Calcinosis Cutis	Associate	24358122
Carcinogenesis	Associate	15800679, 24333468, 31177095
Carcinogenesis	Inhibit	21310043
Carcinoma Hepatocellular	Associate	24696415
Carcinoma Ovarian Epithelial	Associate	21789222
Carcinoma Papillary	Associate	17449941
Carcinoma Renal Cell	Associate	15858144, 17449941, 18587324, 20679884, 31998788
Carcinoma Squamous Cell	Inhibit	16647955
Carcinoma Squamous Cell	Associate	17585317, 27687058, 27884700
Cell Transformation Neoplastic	Associate	25778318
Colonic Neoplasms	Associate	26455323
Colorectal Neoplasms	Associate	17579117, 25038829, 28381183, 31804558, 38131227
Colorectal Neoplasms	Inhibit	18550915
Corneal dystrophy gelatinous drop like	Associate	20651236
Diabetes Mellitus	Associate	25759378
Ectodermal Dysplasia	Associate	37621953
Endometrial Neoplasms	Associate	18850381
Eosinophilic Esophagitis	Associate	28832026
Esophageal Neoplasms	Inhibit	16647955
Esophageal Squamous Cell Carcinoma	Inhibit	16647955
Esophageal Squamous Cell Carcinoma	Associate	17255337
Fibrosis	Stimulate	24696415
Idiopathic Noncirrhotic Portal Hypertension	Associate	24696415
Idiopathic Pulmonary Fibrosis	Associate	18955738
Kidney Neoplasms	Associate	15858144
Laryngeal Neoplasms	Associate	31115553
Liver Cirrhosis	Associate	24696415
Lung Neoplasms	Inhibit	21641901, 23433123
Lung Neoplasms	Associate	29512497
Lymphatic Metastasis	Inhibit	16647955, 24333468, 36232536
Lymphatic Metastasis	Associate	18084611, 18550915, 29901188
Lymphatic Vessel Tumors	Associate	18084611
Malignant mesenchymal tumor	Associate	26919310
Mesothelioma	Associate	16505274
Mesothelioma Malignant	Associate	16505274
Nasopharyngeal Carcinoma	Associate	25778318
Nasopharyngeal Neoplasms	Associate	28055967
Neoplasm Metastasis	Associate	16647955, 26054340, 31115553, 31998788, 32855654, 39175074
Neoplasm Metastasis	Stimulate	17579117
Neoplasm Metastasis	Inhibit	28055967
Neoplasms	Associate	15800679, 16647955, 16836752, 17060315, 17255337, 17649771, 18550915, 19643405, 23230278, 24622401, 25038829, 26004767, 28055967, 29475913, 32816956, 35435371, 37621953, 39175074 View all (3 more)
Neoplasms	Inhibit	21310043, 21641901, 22043024, 25351113, 38131227
Neoplasms	Stimulate	21789222, 23856835, 36412442
Neoplasms Basal Cell	Associate	22043024
Obesity	Associate	25759378
Oncocytoma renal	Associate	17449941
Ovarian Neoplasms	Associate	21789222
Pancreatic Intraductal Neoplasms	Associate	36588491
Pancreatic Neoplasms	Stimulate	16836752
Pancreatic Neoplasms	Associate	26028104
Personality Disorders	Associate	24358122
Prostatic Neoplasms	Associate	24358122
Prostatitis	Associate	37518873
Psoriasis	Inhibit	19661441
Retinal Dysplasia	Inhibit	21310043
Rhinitis Allergic	Associate	33441633
Sarcoidosis	Associate	18955738
Sarcoma Synovial	Associate	17060315
Skin Neoplasms	Associate	24294371
Squamous Cell Carcinoma of Head and Neck	Associate	23856835, 31018946, 31115553, 36232536
Stomach Neoplasms	Associate	24333468, 29901188, 32816956, 36588491
Thyroid Carcinoma Anaplastic	Associate	24727741
Thyroiditis	Stimulate	16836752
Triple Negative Breast Neoplasms	Associate	22638807, 23443971, 24390667, 29475913, 38124743
Urinary Bladder Diseases	Associate	16836752
Urinary Bladder Neoplasms	Associate	35435371
Urticaria Solar	Associate	24294371
Uterine Cervical Neoplasms	Associate	26464708
Uterine Cervicitis	Associate	39175074

CLDN7 (claudin 7)