Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
136259
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 14
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF14
Synonyms (NCBI Gene) Gene synonyms aliases
BTEB5
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q32.2
Summary Summary of gene provided in NCBI Entrez Gene.
This intronless gene encodes a member of the Kruppel-like family of transcription factors. The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene e
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051059 hsa-miR-16-5p CLASH 23622248
MIRT047783 hsa-miR-30d-5p CLASH 23622248
MIRT043907 hsa-miR-378a-3p CLASH 23622248
MIRT735836 hsa-miR-374a-3p Luciferase reporter assay, Western blotting, qRT-PCR 32799891
MIRT1096203 hsa-miR-3121-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609393 23025 ENSG00000266265
Protein
UniProt ID Q8TD94
Protein name Krueppel-like factor 14 (Basic transcription element-binding protein 5) (BTE-binding protein 5) (Transcription factor BTEB5)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 195 219 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 225 249 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 255 277 Zinc finger, C2H2 type Domain
Sequence
MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAPPESALPGPGPPGP
ASVPQLPQVPAPSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPC
SVQTPCSELAPASGAAAVCAPESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAAD
QAPRRRSVTPAAKRHQCPFPGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSD
ELARHYRTH
TGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPPL
TSEVESSASGSGPGPAPSFTTCL
Sequence length 323
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Circulating leptin levels or type 2 diabetes, Body fat percentage and type 2 diabetes (pairwise), Type 2 diabetes (PheCode 250.2), Type 2 diabetes (adjusted for BMI), Triglyceride levels in non-type 2 diabetes, Type 2 diabetes N/A N/A GWAS
Hyperlipidemia Familial combined hyperlipidemia defined by Dutch criteria, Familial combined hyperlipidemia defined by Brunzell criteria N/A N/A GWAS
Hypertension Hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 29849909
Alzheimer disease type 1 Associate 29849909
Brain Neoplasms Associate 35577881
Carcinogenesis Associate 30745849
Carcinoma Hepatocellular Associate 37997542
Cardiovascular Diseases Associate 37351102
Colorectal Neoplasms Associate 28423541
Colorectal Neoplasms Inhibit 30745849
Cytokine Release Syndrome Associate 37868981
Diabetes Mellitus Associate 26670163