KLF14 (KLF transcription factor 14)

Gene

• Entrez ID: 136259
• Gene name: KLF transcription factor 14
• Gene symbol: KLF14
• Synonyms (NCBI Gene): BTEB5
• Chromosome: 7
• Chromosome location: 7q32.2
• Summary: This intronless gene encodes a member of the Kruppel-like family of transcription factors. The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051059	hsa-miR-16-5p	CLASH	23622248
MIRT047783	hsa-miR-30d-5p	CLASH	23622248
MIRT043907	hsa-miR-378a-3p	CLASH	23622248
MIRT735836	hsa-miR-374a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32799891
MIRT1096203	hsa-miR-3121-3p	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921244	hsa-miR-4269	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921246	hsa-miR-4514	CLIP-seq
MIRT1921247	hsa-miR-4692	CLIP-seq
MIRT1921248	hsa-miR-4742-5p	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT2025972	hsa-miR-1229	CLIP-seq
MIRT2025973	hsa-miR-4268	CLIP-seq
MIRT1921244	hsa-miR-4269	CLIP-seq
MIRT2025974	hsa-miR-4300	CLIP-seq
MIRT1921246	hsa-miR-4514	CLIP-seq
MIRT1921247	hsa-miR-4692	CLIP-seq
MIRT1921248	hsa-miR-4742-5p	CLIP-seq
MIRT2025975	hsa-miR-4757-5p	CLIP-seq
MIRT2025976	hsa-miR-920	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT2430451	hsa-miR-23a	CLIP-seq
MIRT2430452	hsa-miR-23b	CLIP-seq
MIRT2430453	hsa-miR-23c	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT2430451	hsa-miR-23a	CLIP-seq
MIRT2430452	hsa-miR-23b	CLIP-seq
MIRT2430453	hsa-miR-23c	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT2430451	hsa-miR-23a	CLIP-seq
MIRT2430452	hsa-miR-23b	CLIP-seq
MIRT2430453	hsa-miR-23c	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT2452626	hsa-miR-2392	CLIP-seq
MIRT2452627	hsa-miR-3153	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003682	Function	Chromatin binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24759103
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	24759103
GO:0046872	Function	Metal ion binding	IEA
GO:1902070	Process	Positive regulation of sphingolipid mediated signaling pathway	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 609393
• HGNC: 23025
• e!Ensembl: ENSG00000266265

Protein

• UniProt ID: Q8TD94
• Protein name: Krueppel-like factor 14 (Basic transcription element-binding protein 5) (BTE-binding protein 5) (Transcription factor BTEB5)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	195 → 219	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	225 → 249	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	255 → 277	Zinc finger, C2H2 type	Domain

• Sequence:

  MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAPPESALPGPGPPGP
  ASVPQLPQVPAPSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPC
  SVQTPCSELAPASGAAAVCAPESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAAD
  QAPRRRSVTPAAKRHQCPFPGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSD
  ELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPPL
  TSEVESSASGSGPGPAPSFTTCL

• Sequence length: 323

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Diabetes mellitus	Diabetes Mellitus, Non-Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	29632379

Unknown
Disease term	Disease name	Evidence	References	Source
Metabolic Syndrome	Metabolic Syndrome			GWAS
Diabetes	Diabetes			GWAS
Coronary artery disease	Coronary artery disease			GWAS
Hyperlipidemia	Hyperlipidemia			GWAS
Hypertension	Hypertension			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Alzheimer Disease	Associate	29849909
Alzheimer disease type 1	Associate	29849909
Brain Neoplasms	Associate	35577881
Carcinogenesis	Associate	30745849
Carcinoma Hepatocellular	Associate	37997542
Cardiovascular Diseases	Associate	37351102
Colorectal Neoplasms	Associate	28423541
Colorectal Neoplasms	Inhibit	30745849
Cytokine Release Syndrome	Associate	37868981
Diabetes Mellitus	Associate	26670163
Diabetes Mellitus Type 2	Associate	21572415, 22791750, 23630301, 26599349, 26670163, 26927145, 37351102
Dyslipidemias	Associate	37351102
Epstein Barr Virus Infections	Associate	32847849
Glioma	Associate	35577881
Hypertension	Associate	26599349
Insulin Resistance	Associate	22791750, 35456983, 37351102
Ludwig's Angina	Associate	35577881
Metabolic Diseases	Associate	21572415
Metabolic Syndrome	Associate	35168826, 35456983, 40243421
Neoplasms	Inhibit	30745849
Neoplasms Adipose Tissue	Associate	35456983
Obesity	Associate	35456983
Uterine Cervical Neoplasms	Associate	25119587