Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	136259
Gene name	KLF transcription factor 14
Gene symbol	KLF14
Synonyms (NCBI Gene)	BTEB5
Chromosome	7
Chromosome location	7q32.2
Summary	This intronless gene encodes a member of the Kruppel-like family of transcription factors. The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene e

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051059	hsa-miR-16-5p	CLASH	23622248
MIRT047783	hsa-miR-30d-5p	CLASH	23622248
MIRT043907	hsa-miR-378a-3p	CLASH	23622248
MIRT735836	hsa-miR-374a-3p	Luciferase reporter assayWestern blottingqRT-PCR	32799891
MIRT1096203	hsa-miR-3121-3p	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921244	hsa-miR-4269	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921246	hsa-miR-4514	CLIP-seq
MIRT1921247	hsa-miR-4692	CLIP-seq
MIRT1921248	hsa-miR-4742-5p	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT2025972	hsa-miR-1229	CLIP-seq
MIRT2025973	hsa-miR-4268	CLIP-seq
MIRT1921244	hsa-miR-4269	CLIP-seq
MIRT2025974	hsa-miR-4300	CLIP-seq
MIRT1921246	hsa-miR-4514	CLIP-seq
MIRT1921247	hsa-miR-4692	CLIP-seq
MIRT1921248	hsa-miR-4742-5p	CLIP-seq
MIRT2025975	hsa-miR-4757-5p	CLIP-seq
MIRT2025976	hsa-miR-920	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT2430451	hsa-miR-23a	CLIP-seq
MIRT2430452	hsa-miR-23b	CLIP-seq
MIRT2430453	hsa-miR-23c	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT2430451	hsa-miR-23a	CLIP-seq
MIRT2430452	hsa-miR-23b	CLIP-seq
MIRT2430453	hsa-miR-23c	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT2430451	hsa-miR-23a	CLIP-seq
MIRT2430452	hsa-miR-23b	CLIP-seq
MIRT2430453	hsa-miR-23c	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT2452626	hsa-miR-2392	CLIP-seq
MIRT2452627	hsa-miR-3153	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24759103
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	24759103
GO:0046872	Function	Metal ion binding	IEA
GO:1902070	Process	Positive regulation of sphingolipid mediated signaling pathway	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
609393	23025	ENSG00000266265

Q8TD94

Protein name

Krueppel-like factor 14 (Basic transcription element-binding protein 5) (BTE-binding protein 5) (Transcription factor BTEB5)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	195 → 219	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	225 → 249	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	255 → 277	Zinc finger, C2H2 type	Domain

Sequence

MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAPPESALPGPGPPGP
ASVPQLPQVPAPSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPC
SVQTPCSELAPASGAAAVCAPESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAAD
QAPRRRSVTPAAKRHQCPFPGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSD
ELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPPL
TSEVESSASGSGPGPAPSFTTCL

Sequence length

323

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
KLF14-related disorder	Likely benign	rs146271852	RCV003899745

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	29849909
Alzheimer disease type 1	Associate	29849909
Brain Neoplasms	Associate	35577881
Carcinogenesis	Associate	30745849
Carcinoma Hepatocellular	Associate	37997542
Cardiovascular Diseases	Associate	37351102
Colorectal Neoplasms	Associate	28423541
Colorectal Neoplasms	Inhibit	30745849
Cytokine Release Syndrome	Associate	37868981
Diabetes Mellitus	Associate	26670163
Diabetes Mellitus Type 2	Associate	21572415, 22791750, 23630301, 26599349, 26670163, 26927145, 37351102
Dyslipidemias	Associate	37351102
Epstein Barr Virus Infections	Associate	32847849
Glioma	Associate	35577881
Hypertension	Associate	26599349
Insulin Resistance	Associate	22791750, 35456983, 37351102
Ludwig's Angina	Associate	35577881
Metabolic Diseases	Associate	21572415
Metabolic Syndrome	Associate	35168826, 35456983, 40243421
Neoplasms	Inhibit	30745849
Neoplasms Adipose Tissue	Associate	35456983
Obesity	Associate	35456983
Uterine Cervical Neoplasms	Associate	25119587

KLF14 (KLF transcription factor 14)