CPA2 (carboxypeptidase A2)

Gene

• Entrez ID: 1358
• Gene name: Carboxypeptidase A2
• Gene symbol: CPA2
• Synonyms (NCBI Gene): -
• Chromosome: 7
• Chromosome location: 7q32.2
• Summary: Three different forms of human pancreatic procarboxypeptidase A have been isolated. The encoded protein represents the A2 form, which is a monomeric protein with different biochemical properties from the A1 and A3 forms. The A2 form of pancreatic procarbo

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004180	Function	Carboxypeptidase activity	IDA	2920728
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IBA
GO:0004181	Function	Metallocarboxypeptidase activity	IDA	2920728, 20385563
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	TAS	2920728
GO:0005576	Component	Extracellular region	IDA	2920728
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005773	Component	Vacuole	IEA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007039	Process	Protein catabolic process in the vacuole	TAS	2920728
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IDA	2920728
GO:0008270	Function	Zinc ion binding	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 600688
• HGNC: 2297
• e!Ensembl: ENSG00000158516

Protein

• UniProt ID: P48052
• Protein name: Carboxypeptidase A2 (EC 3.4.17.15)
• Protein function: Carboxypeptidase that catalyzes the release of a C-terminal amino acid, with a preference for large aromatic C-terminal residues.
• PDB: 1AYE, 1DTD, 1O6X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02244	Propep_M14	28 → 102	Carboxypeptidase activation peptide	Domain
  PF00246	Peptidase_M14	129 → 406	Zinc carboxypeptidase	Domain

• Sequence:

  MAMRLILFFGALFGHIYCLETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTT
  PGETAHVRVPFVNVQAVKVFLESQGIAYSIMIEDVQVLLDKENEEMLFNRRRERSGNFNF
  GAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHA
  REWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTR
  SKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVDFIKSHGKVK
  AFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQA
  SGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY

• Sequence length: 419

Pathways

KEGG:

Pancreatic secretion
Protein digestion and absorption

<