MUCL3 (mucin like 3)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
135656
Gene name Gene Name - the full gene name approved by the HGNC.
Mucin like 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MUCL3
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf37, DPCR1, PBLT
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005575 Component Cellular_component ND
GO:0005737 Component Cytoplasm IEA
GO:0005886 Component Plasma membrane IEA
GO:0008150 Process Biological_process ND
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613928 21666 ENSG00000168631
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q3MIW9
Protein name Mucin-like protein 3 (Diffuse panbronchiolitis critical region protein 1)
Protein function May modulate NF-kappaB signaling and play a role in cell growth.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in lung, esophagus, stomach, rectum, skin, cervix, testis, kidney, uterus and small intestine (PubMed:12185533). Expressed in pancreas (at protein level) (PubMed:29242154). {ECO:0000269|PubMed:12185533, ECO:0000269|PubMed:2924
Sequence 
MAQPVHSLCSAFGLQCCLLFLLASWGAGATTFQEYQKTGELSTSDHIFPLTPGLVYSIPF
DHIVLHSGQRPPELPKSTEIHEQKRHCNTTRHSKPTDKPTGNSKTIDHKSSTDNHEAPPT
SEENSSNQGKDPMIRNQRSVDPADSTTTHKESAGKKHITPAPKSKINCRKSTTGKSTVTR
KSDKTGRPLEKSMSTLDKTSTSSHKTTTSFHNSGNSQTKQKSTSFPEKITAASKTTYKTT
GTPEESEKTEDSRTTVASDKLLTKTTKNIQETISANELTQSLAEPTEHGGRTANENNTPS
PAEPTENRERTANENKKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTA
AVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNES
HPYLNKDGSQKGIHAGQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTL
TQNTQYNDAEDEGGPNSYPVYLMEQQNLGMGQIPSPR
Sequence length 517
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Mental Depression Major depressive disorder N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Show/Hide Text Mining Associations (7)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cholangiocarcinoma Associate 35716043
Colonic Neoplasms Associate 35593226
Esophageal Squamous Cell Carcinoma Associate 24595008
Fatigue Syndrome Chronic Associate 34403736
Metaplasia Associate 20398667
Neoplasms Associate 35593226
Thyroid Cancer Papillary Associate 30278442