TRIM40 (tripartite motif containing 40)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 135644
Gene name Tripartite motif containing 40
Gene symbol TRIM40
Synonyms (NCBI Gene)
RNF35
Chromosome 6
Chromosome location 6p22.1
Summary This gene encodes a member of the tripartite motif (TRIM) protein family. The encoded protein may play a role as a negative regulator against inflammation and carcinogenesis in the gastrointestinal tract. Alternatively spliced transcript variants that enc
miRNA miRNA information provided by mirtarbase database.
11
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (11)
miRTarBase ID miRNA Experiments Reference
MIRT017261 hsa-miR-335-5p Microarray 18185580
MIRT1454731 hsa-miR-1293 CLIP-seq
MIRT1454732 hsa-miR-1301 CLIP-seq
MIRT1454733 hsa-miR-3153 CLIP-seq
MIRT1454734 hsa-miR-4483 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21474709
GO:0005737 Component Cytoplasm IBA
GO:0008270 Function Zinc ion binding IEA
GO:0008385 Component IkappaB kinase complex IDA 21474709
GO:0016740 Function Transferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
616976 18736 ENSG00000204614
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6P9F5
Protein name E3 ubiquitin ligase TRIM40 (EC 2.3.2.27) (Probable E3 NEDD8-protein ligase) (RING finger protein 35)
Protein function E3 ubiquitin-protein ligase that plays a role in the limitation of the innate immune response (PubMed:21474709, PubMed:29117565). Mediates inhibition of the RLR signaling pathway by ubiquitinating RIGI and IFIH1 receptors, leading to their prote
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13445 zf-RING_UBOX 14 → 54 RING-type zinc-finger Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in normal gastrointestinal epithelia but that is down-regulated in gastrointestinal carcinomas and chronic inflammatory lesions of the gastrointestinal tract. {ECO:0000269|PubMed:21474709}.
Sequence 
MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPC
SEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNR
RSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLG
QLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIY
PQLEKGVSELLLQPPQKL
Sequence length 258
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clear cell carcinoma of kidney Benign rs115651142 RCV005908087
Colon adenocarcinoma Benign rs115651142 RCV005908086
Gastric cancer Benign rs115651142 RCV005908088
Show/Hide Text Mining Associations (8)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 40244264
Autoimmune Diseases Associate 21682861
Carcinogenesis Inhibit 21474709
Chronic Disease Inhibit 21474709
Gastrointestinal Diseases Associate 21474709
Gastrointestinal Neoplasms Inhibit 21474709
Inflammation Inhibit 21474709
Urologic Diseases Inhibit 21474709