TRIM40 (tripartite motif containing 40)

Gene

• Entrez ID: 135644
• Gene name: Tripartite motif containing 40
• Gene symbol: TRIM40
• Synonyms (NCBI Gene): RNF35
• Chromosome: 6
• Chromosome location: 6p22.1
• Summary: This gene encodes a member of the tripartite motif (TRIM) protein family. The encoded protein may play a role as a negative regulator against inflammation and carcinogenesis in the gastrointestinal tract. Alternatively spliced transcript variants that enc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017261	hsa-miR-335-5p	Microarray	18185580
MIRT1454731	hsa-miR-1293	CLIP-seq
MIRT1454732	hsa-miR-1301	CLIP-seq
MIRT1454733	hsa-miR-3153	CLIP-seq
MIRT1454734	hsa-miR-4483	CLIP-seq
MIRT1454735	hsa-miR-4652-3p	CLIP-seq
MIRT1454736	hsa-miR-4668-5p	CLIP-seq
MIRT1454737	hsa-miR-5047	CLIP-seq
MIRT2136201	hsa-miR-4742-5p	CLIP-seq
MIRT2434363	hsa-miR-224	CLIP-seq
MIRT2434364	hsa-miR-664	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21474709
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0008270	Function	Zinc ion binding	IEA
GO:0008385	Component	IkappaB kinase complex	IDA	21474709
GO:0010468	Process	Regulation of gene expression	IBA	21873635
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	21474709
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	21474709
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045116	Process	Protein neddylation	IDA	21474709
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:1900181	Process	Negative regulation of protein localization to nucleus	IDA	21474709
GO:1901223	Process	Negative regulation of NIK/NF-kappaB signaling	NAS	21474709

Other IDs

• MIM: 616976
• HGNC: 18736
• e!Ensembl: ENSG00000204614

Protein

• UniProt ID: Q6P9F5
• Protein name: E3 ubiquitin ligase TRIM40 (EC 2.3.2.27) (Probable E3 NEDD8-protein ligase) (RING finger protein 35)
• Protein function: E3 ubiquitin-protein ligase that plays a role in the limitation of the innate immune response (PubMed:21474709, PubMed:29117565). Mediates inhibition of the RLR signaling pathway by ubiquitinating RIGI and IFIH1 receptors, leading to their prote
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13445	zf-RING_UBOX	14 → 54	RING-type zinc-finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in normal gastrointestinal epithelia but that is down-regulated in gastrointestinal carcinomas and chronic inflammatory lesions of the gastrointestinal tract. {ECO:0000269|PubMed:21474709}.
• Sequence:

  MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPC
  SEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNR
  RSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLG
  QLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIY
  PQLEKGVSELLLQPPQKL

• Sequence length: 258

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Dermatitis	Dermatitis, Irritant	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	27258892
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	17632545
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	19503088, 17804836

Unknown
Disease term	Disease name	Evidence	References	Source
Psoriasis	Psoriasis			GWAS
Dental caries	Dental caries			GWAS
Takayasu Arteritis	Takayasu Arteritis			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Alzheimer Disease	Associate	40244264
Autoimmune Diseases	Associate	21682861
Carcinogenesis	Inhibit	21474709
Chronic Disease	Inhibit	21474709
Gastrointestinal Diseases	Associate	21474709
Gastrointestinal Neoplasms	Inhibit	21474709
Inflammation	Inhibit	21474709
Urologic Diseases	Inhibit	21474709