TRIM40 (tripartite motif containing 40)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
135644
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 40
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM40
Synonyms (NCBI Gene) Gene synonyms aliases
RNF35
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the tripartite motif (TRIM) protein family. The encoded protein may play a role as a negative regulator against inflammation and carcinogenesis in the gastrointestinal tract. Alternatively spliced transcript variants that enc
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT017261 hsa-miR-335-5p Microarray 18185580
MIRT1454731 hsa-miR-1293 CLIP-seq
MIRT1454732 hsa-miR-1301 CLIP-seq
MIRT1454733 hsa-miR-3153 CLIP-seq
MIRT1454734 hsa-miR-4483 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21474709
GO:0005737 Component Cytoplasm IBA
GO:0008270 Function Zinc ion binding IEA
GO:0008385 Component IkappaB kinase complex IDA 21474709
GO:0016740 Function Transferase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
616976 18736 ENSG00000204614
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6P9F5
Protein name E3 ubiquitin ligase TRIM40 (EC 2.3.2.27) (Probable E3 NEDD8-protein ligase) (RING finger protein 35)
Protein function E3 ubiquitin-protein ligase that plays a role in the limitation of the innate immune response (PubMed:21474709, PubMed:29117565). Mediates inhibition of the RLR signaling pathway by ubiquitinating RIGI and IFIH1 receptors, leading to their prote
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13445 zf-RING_UBOX 14 → 54 RING-type zinc-finger Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in normal gastrointestinal epithelia but that is down-regulated in gastrointestinal carcinomas and chronic inflammatory lesions of the gastrointestinal tract. {ECO:0000269|PubMed:21474709}.
Sequence 
MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPC
SEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNR
RSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLG
QLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIY
PQLEKGVSELLLQPPQKL
Sequence length 258
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dental caries Dental caries N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Takayasu Arteritis Takayasu arteritis N/A N/A GWAS
Show/Hide Text Mining Associations (8)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 40244264
Autoimmune Diseases Associate 21682861
Carcinogenesis Inhibit 21474709
Chronic Disease Inhibit 21474709
Gastrointestinal Diseases Associate 21474709
Gastrointestinal Neoplasms Inhibit 21474709
Inflammation Inhibit 21474709
Urologic Diseases Inhibit 21474709