Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	135154
Gene name	Succinate dehydrogenase complex assembly factor 4
Gene symbol	SDHAF4
Synonyms (NCBI Gene)	C6orf57Sdh8
Chromosome	6
Chromosome location	6q13

Show/Hide all (34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT740307	hsa-miR-3155a	HITS-CLIP	19536157
MIRT740308	hsa-miR-3155b	HITS-CLIP	19536157
MIRT740309	hsa-miR-484	HITS-CLIP	19536157
MIRT740310	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT740311	hsa-miR-4469	HITS-CLIP	19536157
MIRT740312	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT740313	hsa-miR-4287	HITS-CLIP	19536157
MIRT740314	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT740315	hsa-miR-3663-5p	HITS-CLIP	19536157
MIRT740316	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT740317	hsa-miR-6131	HITS-CLIP	19536157
MIRT740318	hsa-miR-6801-5p	HITS-CLIP	19536157
MIRT740319	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT740320	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT740321	hsa-miR-6867-3p	HITS-CLIP	19536157
MIRT740322	hsa-miR-5587-5p	HITS-CLIP	19536157
MIRT740323	hsa-miR-6843-3p	HITS-CLIP	19536157
MIRT740324	hsa-miR-6848-3p	HITS-CLIP	19536157
MIRT740320	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT740319	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT740310	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT741908	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT740316	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT741909	hsa-miR-623	HITS-CLIP	23824327
MIRT741910	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT741911	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT741912	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT741913	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT741914	hsa-miR-3685	HITS-CLIP	23824327
MIRT741915	hsa-miR-384	HITS-CLIP	23824327
MIRT741916	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT742356	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT742357	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT742358	hsa-miR-4634	HITS-CLIP	23824327

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006099	Process	Tricarboxylic acid cycle	TAS
GO:0006457	Process	Protein folding	IEA
GO:0008047	Function	Enzyme activator activity	IEA
GO:0008047	Function	Enzyme activator activity	ISS
GO:0034553	Process	Mitochondrial respiratory chain complex II assembly	IBA
GO:0034553	Process	Mitochondrial respiratory chain complex II assembly	IEA
GO:0034553	Process	Mitochondrial respiratory chain complex II assembly	IGI	24954416
GO:0044183	Function	Protein folding chaperone	TAS
GO:0045087	Process	Innate immune response	IEA
GO:0045333	Process	Cellular respiration	IEA
GO:0045333	Process	Cellular respiration	IGI	24954416

MIM	HGNC	e!Ensembl
619198	20957	ENSG00000154079

Q5VUM1

Protein name

Succinate dehydrogenase assembly factor 4, mitochondrial (SDH assembly factor 4) (SDHAF4)

Protein function

Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chai

PDB

8DYD , 8DYE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07896	DUF1674	59 → 108	Protein of unknown function (DUF1674)	Family

Sequence

MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDA
PEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF

Sequence length

108

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Diabetes Gestational	Associate	36672824	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Associate	32948195	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	36672824	★★★★★ ★☆☆☆☆ Found in Text Mining only

SDHAF4 (succinate dehydrogenase complex assembly factor 4)