Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
135154
Gene name Gene Name - the full gene name approved by the HGNC.
Succinate dehydrogenase complex assembly factor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SDHAF4
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf57, Sdh8
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q13
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT740307 hsa-miR-3155a HITS-CLIP 19536157
MIRT740308 hsa-miR-3155b HITS-CLIP 19536157
MIRT740309 hsa-miR-484 HITS-CLIP 19536157
MIRT740310 hsa-miR-6832-3p HITS-CLIP 19536157
MIRT740311 hsa-miR-4469 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 32296183
GO:0005575 Component Cellular_component ND
GO:0005739 Component Mitochondrion IBA 21873635
GO:0005749 Component Mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone) ISS 24954416
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619198 20957 ENSG00000154079
Protein
UniProt ID Q5VUM1
Protein name Succinate dehydrogenase assembly factor 4, mitochondrial (SDH assembly factor 4) (SDHAF4)
Protein function Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chai
PDB 8DYD , 8DYE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07896 DUF1674 59 108 Protein of unknown function (DUF1674) Family
Sequence
MTPSRLPWLLSWVSATAWRAARSPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDA
PEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF
Sequence length 108
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
21490949
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Diabetes Gestational Associate 36672824
Paraganglioma Associate 32948195
Thyroid Neoplasms Associate 36672824