PACRG (parkin coregulated)

Gene

• Entrez ID: 135138
• Gene name: Parkin coregulated
• Gene symbol: PACRG
• Synonyms (NCBI Gene): BUG21, GLUP, HAK005771, PACRG2.1, PARK2CRG, pf12
• Chromosome: 6
• Chromosome location: 6q26
• Summary: This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson`s disease. These genes are co-

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029821	hsa-miR-26b-5p	Microarray	19088304
MIRT734318	hsa-miR-5571-3p	Immunofluorescence, qRT-PCR, RNA-seq, Western blotting	31735554
MIRT734319	hsa-miR-146b-3p	Immunofluorescence, qRT-PCR, RNA-seq, Western blotting	31735554
MIRT734320	hsa-miR-21-5p	Immunofluorescence, qRT-PCR, RNA-seq, Western blotting	31735554
MIRT2060139	hsa-miR-1245b-3p	CLIP-seq
MIRT2060139	hsa-miR-1245b-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IPI	14532270
GO:0002177	Component	Manchette	IEA
GO:0003779	Function	Actin binding	IDA	14532270
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	14532270
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IDA	36191189
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005929	Component	Cilium	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030544	Function	Hsp70 protein binding	IBA
GO:0030544	Function	Hsp70 protein binding	IDA	14532270
GO:0031072	Function	Heat shock protein binding	IPI	14532270
GO:0031514	Component	Motile cilium	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	14532270
GO:0031982	Component	Vesicle	IBA
GO:0031982	Component	Vesicle	IDA	14532270
GO:0031982	Component	Vesicle	IEA
GO:0034620	Process	Cellular response to unfolded protein	TAS	14532270
GO:0036126	Component	Sperm flagellum	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IDA	14532270
GO:0043005	Component	Neuron projection	IEA
GO:0043014	Function	Alpha-tubulin binding	IDA	14532270
GO:0044297	Component	Cell body	IEA
GO:0048487	Function	Beta-tubulin binding	IDA	14532270
GO:0051087	Function	Protein-folding chaperone binding	IPI	14532270
GO:0051879	Function	Hsp90 protein binding	IBA
GO:0051879	Function	Hsp90 protein binding	IDA	14532270
GO:0097225	Component	Sperm midpiece	IEA
GO:0097386	Component	Glial cell projection	IEA
GO:0160112	Component	Axonemal B tubule inner sheath	IEA

Other IDs

• MIM: 608427
• HGNC: 19152
• e!Ensembl: ENSG00000112530

Protein

• UniProt ID: Q96M98
• Protein name: Parkin coregulated gene protein (Molecular chaperone/chaperonin-binding protein) (PARK2 coregulated gene protein)
• Protein function: Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating (PubMed:36191189). Suppresses cell death induced by accumulation of unfolded Pael receptor (Pae
• PDB: 6NDU, 6NEP, 6UCC, 7UNG, 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10274	ParcG	70 → 218	Parkin co-regulated protein	Family
  PF10274	ParcG	233 → 292	Parkin co-regulated protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all immune tissues, spleen, lymph nodes, thymus, tonsils, leukocyte and bone marrow. Expressed also in heart, brain, skeletal muscle, kidney, lung and pancreas. Expressed in primary Schwann cells and very weakly by monocyt
• Sequence:

  MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAG
  AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMT
  FPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAE
  MVGKALVPYYRQILPVLNIFKNMNGSYSLPRLECSGAIMARCNLDHLGSSDPPTSASQVA
  EIIVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN

• Sequence length: 296

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Cervical cancer	Benign	rs57286197	RCV005912073
Lung cancer	Benign	rs57286197	RCV005912075
Ovarian serous cystadenocarcinoma	Benign	rs57286197	RCV005912074

Associations from Text Mining
Disease Name	Relationship Type	References
Azoospermia	Associate	19268936
Buruli Ulcer	Associate	27128681
Carcinoma Renal Cell	Inhibit	18592004
Glioblastoma	Associate	16582634
Infections	Associate	16734611
Leprosy	Associate	16734611, 23861666, 32433683
Leukemia	Associate	23733339
Lewy Body Disease	Associate	14532270
Nasopharyngeal Carcinoma	Associate	32271791
Ovarian Neoplasms	Associate	27286703
Paratyphoid Fever	Associate	16734611
Parkinson Disease	Associate	14532270
Typhoid Fever	Associate	16734611