Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	135138
Gene name Gene Name - the full gene name approved by the HGNC.	Parkin coregulated
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PACRG
Synonyms (NCBI Gene) Gene synonyms aliases	BUG21, GLUP, HAK005771, PACRG2.1, PARK2CRG, pf12
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q26
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson`s disease. These genes are co-

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029821	hsa-miR-26b-5p	Microarray	19088304
MIRT734318	hsa-miR-5571-3p	Immunofluorescence, qRT-PCR, RNA-seq, Western blotting	31735554
MIRT734319	hsa-miR-146b-3p	Immunofluorescence, qRT-PCR, RNA-seq, Western blotting	31735554
MIRT734320	hsa-miR-21-5p	Immunofluorescence, qRT-PCR, RNA-seq, Western blotting	31735554
MIRT2060139	hsa-miR-1245b-3p	CLIP-seq
MIRT2060139	hsa-miR-1245b-3p	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IPI	14532270
GO:0002177	Component	Manchette	IEA
GO:0003779	Function	Actin binding	IDA	14532270
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA	14532270
GO:0007286	Process	Spermatid development	IEA
GO:0030544	Function	Hsp70 protein binding	IBA	21873635
GO:0030544	Function	Hsp70 protein binding	IDA	14532270
GO:0031072	Function	Heat shock protein binding	IPI	14532270
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	14532270
GO:0031982	Component	Vesicle	IBA	21873635
GO:0031982	Component	Vesicle	IDA	14532270
GO:0034613	Process	Cellular protein localization	IEA
GO:0034620	Process	Cellular response to unfolded protein	TAS	14532270
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043005	Component	Neuron projection	IDA	14532270
GO:0043014	Function	Alpha-tubulin binding	IDA	14532270
GO:0044297	Component	Cell body	IEA
GO:0048487	Function	Beta-tubulin binding	IDA	14532270
GO:0051087	Function	Chaperone binding	IBA	21873635
GO:0051087	Function	Chaperone binding	IPI	14532270
GO:0051879	Function	Hsp90 protein binding	IBA	21873635
GO:0051879	Function	Hsp90 protein binding	IDA	14532270
GO:0060548	Process	Negative regulation of cell death	IBA	21873635
GO:0060548	Process	Negative regulation of cell death	IMP	14532270
GO:0097225	Component	Sperm midpiece	IEA

MIM	HGNC	e!Ensembl
608427	19152	ENSG00000112530

Protein

UniProt ID

Q96M98

Protein name

Parkin coregulated gene protein (Molecular chaperone/chaperonin-binding protein) (PARK2 coregulated gene protein)

Protein function

Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating (PubMed:36191189). Suppresses cell death induced by accumulation of unfolded Pael receptor (Pae

PDB

6NDU , 6NEP , 6UCC , 7UNG , 8J07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10274	ParcG	70 → 218	Parkin co-regulated protein	Family
PF10274	ParcG	233 → 292	Parkin co-regulated protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in all immune tissues, spleen, lymph nodes, thymus, tonsils, leukocyte and bone marrow. Expressed also in heart, brain, skeletal muscle, kidney, lung and pancreas. Expressed in primary Schwann cells and very weakly by monocyt

Sequence

MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAG
AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMT
FPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAE
MVGKALVPYYRQILPVLNIFKNMNGSYSLPRLECSGAIMARCNLDHLGSSDPPTSASQVA
EIIVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN

Sequence length

296

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Parkinson disease	PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Evidence	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome		GWAS
Ovarian cancer	Ovarian cancer	Conditional KD of IL6 in the OCCA xenograft model delays tumor growth	GWAS, CBGDA
Insomnia	Insomnia		GWAS
Stress Disorder	Stress Disorder		GWAS

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
Azoospermia	Associate	19268936
Buruli Ulcer	Associate	27128681
Carcinoma Renal Cell	Inhibit	18592004
Glioblastoma	Associate	16582634
Infections	Associate	16734611
Leprosy	Associate	16734611, 23861666, 32433683
Leukemia	Associate	23733339
Lewy Body Disease	Associate	14532270
Nasopharyngeal Carcinoma	Associate	32271791
Ovarian Neoplasms	Associate	27286703
Paratyphoid Fever	Associate	16734611
Parkinson Disease	Associate	14532270
Typhoid Fever	Associate	16734611

PACRG (parkin coregulated)