Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1350
Gene name Gene Name - the full gene name approved by the HGNC.	Cytochrome c oxidase subunit 7C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	COX7C
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q14.3
Summary Summary of gene provided in NCBI Entrez Gene.	Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochond

Show/Hide all(57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045951	hsa-miR-125b-5p	CLASH	23622248
MIRT043481	hsa-miR-331-3p	CLASH	23622248
MIRT042980	hsa-miR-324-3p	CLASH	23622248
MIRT041272	hsa-miR-193b-3p	CLASH	23622248
MIRT905581	hsa-miR-183	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT905585	hsa-miR-598	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT1968531	hsa-miR-3130-3p	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT1968532	hsa-miR-3180-5p	CLIP-seq
MIRT1968533	hsa-miR-3662	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT1968534	hsa-miR-485-5p	CLIP-seq
MIRT1968535	hsa-miR-520a-5p	CLIP-seq
MIRT1968536	hsa-miR-525-5p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT905581	hsa-miR-183	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905581	hsa-miR-183	CLIP-seq
MIRT1968531	hsa-miR-3130-3p	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT1968532	hsa-miR-3180-5p	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT1968533	hsa-miR-3662	CLIP-seq
MIRT2507946	hsa-miR-3928	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT2507947	hsa-miR-4694-3p	CLIP-seq
MIRT2507948	hsa-miR-4802-5p	CLIP-seq
MIRT1968534	hsa-miR-485-5p	CLIP-seq
MIRT1968535	hsa-miR-520a-5p	CLIP-seq
MIRT2507949	hsa-miR-522	CLIP-seq
MIRT1968536	hsa-miR-525-5p	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT2507950	hsa-miR-765	CLIP-seq
MIRT905581	hsa-miR-183	CLIP-seq
MIRT1968531	hsa-miR-3130-3p	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT1968532	hsa-miR-3180-5p	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT1968533	hsa-miR-3662	CLIP-seq
MIRT2507946	hsa-miR-3928	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT2507947	hsa-miR-4694-3p	CLIP-seq
MIRT2507948	hsa-miR-4802-5p	CLIP-seq
MIRT1968534	hsa-miR-485-5p	CLIP-seq
MIRT1968535	hsa-miR-520a-5p	CLIP-seq
MIRT2507949	hsa-miR-522	CLIP-seq
MIRT1968536	hsa-miR-525-5p	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT2507950	hsa-miR-765	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
YY1	Activation	9092564

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004129	Function	Cytochrome-c oxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	31536960, 32296183
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005751	Component	Mitochondrial respiratory chain complex IV	IDA	31536960
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	2155413
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	IBA	21873635
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	TAS
GO:0016021	Component	Integral component of membrane	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
603774	2292	ENSG00000127184

Protein

UniProt ID

P15954

Protein name

Cytochrome c oxidase subunit 7C, mitochondrial (Cytochrome c oxidase polypeptide VIIc)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02935	COX7C	1 → 62	Cytochrome c oxidase subunit VIIc	Family

Sequence

MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
LKT

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	20882379

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	34225819, 36191742
Alzheimer Disease	Inhibit	36195955
Cognitive Dysfunction	Inhibit	36195955
Dementia	Associate	36191742
Diabetes Mellitus Type 1	Associate	33083497
Fatigue Syndrome Chronic	Stimulate	37569433
Peritonitis	Inhibit	24204994
Venous Thromboembolism	Associate	26397997

COX7C (cytochrome c oxidase subunit 7C)