Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1350
Gene name Gene Name - the full gene name approved by the HGNC.	Cytochrome c oxidase subunit 7C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	COX7C
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q14.3
Summary Summary of gene provided in NCBI Entrez Gene.	Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochond

Show/Hide all(57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045951	hsa-miR-125b-5p	CLASH	23622248
MIRT043481	hsa-miR-331-3p	CLASH	23622248
MIRT042980	hsa-miR-324-3p	CLASH	23622248
MIRT041272	hsa-miR-193b-3p	CLASH	23622248
MIRT905581	hsa-miR-183	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT905585	hsa-miR-598	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT1968531	hsa-miR-3130-3p	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT1968532	hsa-miR-3180-5p	CLIP-seq
MIRT1968533	hsa-miR-3662	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT1968534	hsa-miR-485-5p	CLIP-seq
MIRT1968535	hsa-miR-520a-5p	CLIP-seq
MIRT1968536	hsa-miR-525-5p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT905581	hsa-miR-183	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905581	hsa-miR-183	CLIP-seq
MIRT1968531	hsa-miR-3130-3p	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT1968532	hsa-miR-3180-5p	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT1968533	hsa-miR-3662	CLIP-seq
MIRT2507946	hsa-miR-3928	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT2507947	hsa-miR-4694-3p	CLIP-seq
MIRT2507948	hsa-miR-4802-5p	CLIP-seq
MIRT1968534	hsa-miR-485-5p	CLIP-seq
MIRT1968535	hsa-miR-520a-5p	CLIP-seq
MIRT2507949	hsa-miR-522	CLIP-seq
MIRT1968536	hsa-miR-525-5p	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT2507950	hsa-miR-765	CLIP-seq
MIRT905581	hsa-miR-183	CLIP-seq
MIRT1968531	hsa-miR-3130-3p	CLIP-seq
MIRT905582	hsa-miR-3168	CLIP-seq
MIRT1968532	hsa-miR-3180-5p	CLIP-seq
MIRT905583	hsa-miR-325	CLIP-seq
MIRT1968533	hsa-miR-3662	CLIP-seq
MIRT2507946	hsa-miR-3928	CLIP-seq
MIRT905584	hsa-miR-4436b-5p	CLIP-seq
MIRT2507947	hsa-miR-4694-3p	CLIP-seq
MIRT2507948	hsa-miR-4802-5p	CLIP-seq
MIRT1968534	hsa-miR-485-5p	CLIP-seq
MIRT1968535	hsa-miR-520a-5p	CLIP-seq
MIRT2507949	hsa-miR-522	CLIP-seq
MIRT1968536	hsa-miR-525-5p	CLIP-seq
MIRT905586	hsa-miR-628-3p	CLIP-seq
MIRT905587	hsa-miR-640	CLIP-seq
MIRT2507950	hsa-miR-765	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
YY1	Activation	9092564

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	31536960, 32296183
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	2155413
GO:0006119	Process	Oxidative phosphorylation	IEA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	IBA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	IEA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	NAS	30030519
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	30030519
GO:0045277	Component	Respiratory chain complex IV	IDA	31536960
GO:0045277	Component	Respiratory chain complex IV	IEA
GO:0045333	Process	Cellular respiration	NAS	30030519

MIM	HGNC	e!Ensembl
603774	2292	ENSG00000127184

Protein

UniProt ID

P15954

Protein name

Cytochrome c oxidase subunit 7C, mitochondrial (Cytochrome c oxidase polypeptide VIIc)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02935	COX7C	1 → 62	Cytochrome c oxidase subunit VIIc	Family

Sequence

MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
LKT

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

COX7C (cytochrome c oxidase subunit 7C)