Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	135
Gene name	Adenosine A2a receptor
Gene symbol	ADORA2A
Synonyms (NCBI Gene)	A2aRADORA2RDC8
Chromosome	22
Chromosome location	22q11.23
Summary	This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily, which is subdivided into classes and subtypes. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT735114	hsa-miR-885-3p	qRT-PCR	31776299
MIRT769588	hsa-miR-1291	CLIP-seq
MIRT769589	hsa-miR-296-5p	CLIP-seq
MIRT769590	hsa-miR-3173-5p	CLIP-seq
MIRT769591	hsa-miR-4446-3p	CLIP-seq
MIRT769592	hsa-miR-4492	CLIP-seq
MIRT769593	hsa-miR-4498	CLIP-seq
MIRT769594	hsa-miR-4505	CLIP-seq
MIRT769595	hsa-miR-4721	CLIP-seq
MIRT769596	hsa-miR-545	CLIP-seq
MIRT769597	hsa-miR-762	CLIP-seq
MIRT1927034	hsa-miR-2115	CLIP-seq
MIRT1927035	hsa-miR-3180-5p	CLIP-seq
MIRT1927036	hsa-miR-516a-3p	CLIP-seq
MIRT1927037	hsa-miR-520a-5p	CLIP-seq
MIRT1927038	hsa-miR-525-5p	CLIP-seq
MIRT2167913	hsa-miR-1184	CLIP-seq
MIRT2167914	hsa-miR-1205	CLIP-seq
MIRT2167915	hsa-miR-1273f	CLIP-seq
MIRT769588	hsa-miR-1291	CLIP-seq
MIRT769589	hsa-miR-296-5p	CLIP-seq
MIRT2167916	hsa-miR-3145-5p	CLIP-seq
MIRT2167917	hsa-miR-3158-5p	CLIP-seq
MIRT769590	hsa-miR-3173-5p	CLIP-seq
MIRT769591	hsa-miR-4446-3p	CLIP-seq
MIRT769592	hsa-miR-4492	CLIP-seq
MIRT769593	hsa-miR-4498	CLIP-seq
MIRT769594	hsa-miR-4505	CLIP-seq
MIRT769595	hsa-miR-4721	CLIP-seq
MIRT2167918	hsa-miR-483-3p	CLIP-seq
MIRT2167919	hsa-miR-544	CLIP-seq
MIRT2167920	hsa-miR-668	CLIP-seq
MIRT769597	hsa-miR-762	CLIP-seq
MIRT2383950	hsa-miR-138	CLIP-seq
MIRT2383951	hsa-miR-3907	CLIP-seq
MIRT2383952	hsa-miR-4530	CLIP-seq
MIRT2383953	hsa-miR-4693-3p	CLIP-seq
MIRT2383954	hsa-miR-548q	CLIP-seq
MIRT2383955	hsa-miR-663b	CLIP-seq
MIRT2674618	hsa-miR-1182	CLIP-seq
MIRT2674619	hsa-miR-1266	CLIP-seq
MIRT2674620	hsa-miR-1976	CLIP-seq
MIRT2674621	hsa-miR-4290	CLIP-seq
MIRT2674622	hsa-miR-4518	CLIP-seq
MIRT2674623	hsa-miR-4639-3p	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
NFKB1	Unknown	17082635
RELA	Unknown	17082635
YY1	Unknown	20666933
ZNF148	Unknown	20666933

Show/Hide all (94)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001609	Function	G protein-coupled adenosine receptor activity	IBA
GO:0001609	Function	G protein-coupled adenosine receptor activity	IDA	21393508, 21593763
GO:0001609	Function	G protein-coupled adenosine receptor activity	IEA
GO:0001963	Process	Synaptic transmission, dopaminergic	IBA
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IBA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0001975	Process	Response to amphetamine	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	11571652, 12189203, 16027149, 16339847, 16481441, 17356572, 17689978, 19694902, 23296780, 28102227, 28298427, 28734904, 29568380, 31286866, 32296183
GO:0005516	Function	Calmodulin binding	EXP	25692595
GO:0005516	Function	Calmodulin binding	IDA	25692595
GO:0005516	Function	Calmodulin binding	IMP	25692595
GO:0005882	Component	Intermediate filament	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25644539
GO:0005886	Component	Plasma membrane	IDA	16339847
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	21393508
GO:0005886	Component	Plasma membrane	TAS	8794889
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006909	Process	Phagocytosis	TAS	8360491
GO:0006915	Process	Apoptotic process	TAS	7818494
GO:0006954	Process	Inflammatory response	TAS	8360491
GO:0006968	Process	Cellular defense response	TAS	10051547
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10899090
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	21393508
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	7818494
GO:0007271	Process	Synaptic transmission, cholinergic	IEA
GO:0007417	Process	Central nervous system development	TAS	10945659
GO:0007596	Process	Blood coagulation	TAS	10899090
GO:0007600	Process	Sensory perception	TAS	9262401
GO:0007626	Process	Locomotory behavior	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008015	Process	Blood circulation	TAS	9262401
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008289	Function	Lipid binding	IPI	25692595
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0014049	Process	Positive regulation of glutamate secretion	IEA
GO:0014057	Process	Positive regulation of acetylcholine secretion, neurotransmission	IEA
GO:0014061	Process	Regulation of norepinephrine secretion	IEA
GO:0014074	Process	Response to purine-containing compound	IDA	25644539
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10051547
GO:0019899	Function	Enzyme binding	IPI	16339847
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030673	Component	Axolemma	IEA
GO:0031000	Process	Response to caffeine	IEA
GO:0031802	Function	Type 5 metabotropic glutamate receptor binding	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IEA
GO:0032279	Component	Asymmetric synapse	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042802	Function	Identical protein binding	IPI	18675812, 19013155, 29568380
GO:0043025	Component	Neuronal cell body	IEA
GO:0043116	Process	Negative regulation of vascular permeability	IEA
GO:0043279	Process	Response to alkaloid	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045938	Process	Positive regulation of circadian sleep/wake cycle, sleep	IEA
GO:0046636	Process	Negative regulation of alpha-beta T cell activation	IEA
GO:0048143	Process	Astrocyte activation	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0050714	Process	Positive regulation of protein secretion	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0051393	Function	Alpha-actinin binding	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0051899	Process	Membrane depolarization	IEA
GO:0051924	Process	Regulation of calcium ion transport	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060080	Process	Inhibitory postsynaptic potential	IEA
GO:0060134	Process	Prepulse inhibition	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
102776	263	ENSG00000128271

P29274

Protein name

Adenosine receptor A2a

Protein function

Receptor for adenosine (By similarity). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity).

PDB

2YDO , 2YDV , 3EML , 3PWH , 3QAK , 3REY , 3RFM , 3UZA , 3UZC , 3VG9 , 3VGA , 4EIY , 4UG2 , 4UHR , 5G53 , 5IU4 , 5IU7 , 5IU8 , 5IUA , 5IUB , 5JTB , 5K2A , 5K2B , 5K2C , 5K2D , 5MZJ , 5MZP , 5N2R , 5NLX , 5NM2 , 5NM4 , 5OLG , 5OLH , 5OLO , 5OLV , 5OLZ , 5OM1 , 5OM4 , 5UIG , 5UVI , 5VRA , 5WF5 , 5WF6 , 6AQF , 6GDG , 6GT3 , 6JZH , 6LPJ , 6LPK , 6LPL , 6MH8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	23 → 288	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Sequence length

412

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Calcium signaling pathway cAMP signaling pathway Neuroactive ligand-receptor interaction Vascular smooth muscle contraction Parkinson disease Alcoholism		Adenosine P1 receptors G alpha (s) signalling events Surfactant metabolism ADORA2B mediated anti-inflammatory cytokines production

ADORA2A (adenosine A2a receptor)