TAAR1 (trace amine associated receptor 1)

Gene

• Entrez ID: 134864
• Gene name: Trace amine associated receptor 1
• Gene symbol: TAAR1
• Synonyms (NCBI Gene): TA1, TAR1, TRAR1
• Chromosome: 6
• Chromosome location: 6q23.2
• Summary: The protein encoded by this gene is a G-protein coupled receptor activated by trace amines. The encoded protein responds little or not at all to dopamine, serotonin, epinephrine, or histamine, but responds well to beta-phenylethylamine, p-tyramine, octopa

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001594	Function	Trace-amine receptor activity	IBA
GO:0001594	Function	Trace-amine receptor activity	IDA	11459929, 11723224, 31399635, 37935376, 37935377, 37963465, 38168118
GO:0001594	Function	Trace-amine receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IDA	11723224
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	15718104
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	11723224
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15718104
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	12719376, 31399635, 36100653, 37935376, 37935377, 37963465, 38168118
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	34239069
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	37935376, 37963465
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	20966218, 37991948
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	37935376, 37963465
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0008227	Function	G protein-coupled amine receptor activity	IEA
GO:0012505	Component	Endomembrane system	IDA	11723224
GO:0012505	Component	Endomembrane system	IEA
GO:0012505	Component	Endomembrane system	IMP	11723224
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 609333
• HGNC: 17734
• e!Ensembl: ENSG00000146399

Protein

• UniProt ID: Q96RJ0
• Protein name: Trace amine-associated receptor 1 (TaR-1) (Trace amine receptor 1)
• Protein function: Intracellular G-protein coupled receptor for trace amines, which recognizes endogenous amine-containing metabolites such as beta-phenylethylamine (beta-PEA), 3-iodothyronamine (T1AM), isoamylamine (IAA), cadaverine (CAD), cyclohexylamine (CHA),
• PDB: 8JLN, 8JLO, 8JLP, 8JLQ, 8JLR, 8JSO, 8UHB, 8W87, 8W88, 8W89, 8W8A, 8WC8, 8WCA, 8ZSJ, 8ZSP, 8ZSS, 9JKQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	40 → 304	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low level in both the central and peripheral nervous system (PubMed:11459929). Moderately expressed in stomach (PubMed:11459929). Low levels in amygdala, kidney, and lung, and small intestine (PubMed:11459929). Trace amoun
• Sequence:

  MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
  LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
  RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
  GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
  ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
  PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS

• Sequence length: 339

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Amine ligand-binding receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production