Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	134864
Gene name Gene Name - the full gene name approved by the HGNC.	Trace amine associated receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TAAR1
Synonyms (NCBI Gene) Gene synonyms aliases	TA1, TAR1, TRAR1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q23.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a G-protein coupled receptor activated by trace amines. The encoded protein responds little or not at all to dopamine, serotonin, epinephrine, or histamine, but responds well to beta-phenylethylamine, p-tyramine, octopa

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001594	Function	Trace-amine receptor activity	IBA
GO:0001594	Function	Trace-amine receptor activity	IDA	11459929, 11723224, 31399635, 37935376, 37935377, 37963465, 38168118
GO:0001594	Function	Trace-amine receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IDA	11723224
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	15718104
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	11723224
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15718104
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	12719376, 31399635, 36100653, 37935376, 37935377, 37963465, 38168118
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	34239069
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	37935376, 37963465
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	ISS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	20966218, 37991948
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	37935376, 37963465
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0008227	Function	G protein-coupled amine receptor activity	IEA
GO:0012505	Component	Endomembrane system	IDA	11723224
GO:0012505	Component	Endomembrane system	IEA
GO:0012505	Component	Endomembrane system	IMP	11723224
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
609333	17734	ENSG00000146399

Protein

UniProt ID

Q96RJ0

Protein name

Trace amine-associated receptor 1 (TaR-1) (Trace amine receptor 1)

Protein function

Intracellular G-protein coupled receptor for trace amines, which recognizes endogenous amine-containing metabolites such as beta-phenylethylamine (beta-PEA), 3-iodothyronamine (T1AM), isoamylamine (IAA), cadaverine (CAD), cyclohexylamine (CHA),

PDB

8JLN , 8JLO , 8JLP , 8JLQ , 8JLR , 8JSO , 8UHB , 8W87 , 8W88 , 8W89 , 8W8A , 8WC8 , 8WCA , 8ZSJ , 8ZSP , 8ZSS , 9JKQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	40 → 304	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at low level in both the central and peripheral nervous system (PubMed:11459929). Moderately expressed in stomach (PubMed:11459929). Low levels in amygdala, kidney, and lung, and small intestine (PubMed:11459929). Trace amoun

Sequence

MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS

Sequence length

339

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Amine ligand-binding receptors G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

TAAR1 (trace amine associated receptor 1)