Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1345
Gene name Gene Name - the full gene name approved by the HGNC.	Cytochrome c oxidase subunit 6C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	COX6C
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q22.2
Summary Summary of gene provided in NCBI Entrez Gene.	Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multip

Show/Hide all(75)

miRTarBase ID	miRNA	Experiments
MIRT905493	hsa-miR-2053	CLIP-seq
MIRT905494	hsa-miR-3125	CLIP-seq
MIRT905495	hsa-miR-3185	CLIP-seq
MIRT905496	hsa-miR-335	CLIP-seq
MIRT905497	hsa-miR-3607-5p	CLIP-seq
MIRT905498	hsa-miR-3916	CLIP-seq
MIRT905499	hsa-miR-3928	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT905501	hsa-miR-4276	CLIP-seq
MIRT905502	hsa-miR-4504	CLIP-seq
MIRT905503	hsa-miR-4697-3p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905505	hsa-miR-4731-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT905507	hsa-miR-4801	CLIP-seq
MIRT905508	hsa-miR-569	CLIP-seq
MIRT905509	hsa-miR-592	CLIP-seq
MIRT905510	hsa-miR-597	CLIP-seq
MIRT905511	hsa-miR-664	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905494	hsa-miR-3125	CLIP-seq
MIRT905496	hsa-miR-335	CLIP-seq
MIRT905498	hsa-miR-3916	CLIP-seq
MIRT905499	hsa-miR-3928	CLIP-seq
MIRT905494	hsa-miR-3125	CLIP-seq
MIRT905496	hsa-miR-335	CLIP-seq
MIRT905497	hsa-miR-3607-5p	CLIP-seq
MIRT905498	hsa-miR-3916	CLIP-seq
MIRT905499	hsa-miR-3928	CLIP-seq
MIRT1968511	hsa-miR-3973	CLIP-seq
MIRT905501	hsa-miR-4276	CLIP-seq
MIRT905502	hsa-miR-4504	CLIP-seq
MIRT1968512	hsa-miR-4693-5p	CLIP-seq
MIRT905503	hsa-miR-4697-3p	CLIP-seq
MIRT905505	hsa-miR-4731-3p	CLIP-seq
MIRT905507	hsa-miR-4801	CLIP-seq
MIRT1968513	hsa-miR-548l	CLIP-seq
MIRT905509	hsa-miR-592	CLIP-seq
MIRT905510	hsa-miR-597	CLIP-seq
MIRT905511	hsa-miR-664	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905497	hsa-miR-3607-5p	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT905501	hsa-miR-4276	CLIP-seq
MIRT905502	hsa-miR-4504	CLIP-seq
MIRT905503	hsa-miR-4697-3p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905505	hsa-miR-4731-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT905507	hsa-miR-4801	CLIP-seq
MIRT905509	hsa-miR-592	CLIP-seq
MIRT905510	hsa-miR-597	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905511	hsa-miR-664	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905493	hsa-miR-2053	CLIP-seq
MIRT905495	hsa-miR-3185	CLIP-seq
MIRT1968511	hsa-miR-3973	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT1968512	hsa-miR-4693-5p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT2507897	hsa-miR-539	CLIP-seq
MIRT1968513	hsa-miR-548l	CLIP-seq
MIRT2507898	hsa-miR-548u	CLIP-seq
MIRT905508	hsa-miR-569	CLIP-seq
MIRT905495	hsa-miR-3185	CLIP-seq
MIRT1968511	hsa-miR-3973	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT1968512	hsa-miR-4693-5p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT2507897	hsa-miR-539	CLIP-seq
MIRT1968513	hsa-miR-548l	CLIP-seq
MIRT2507898	hsa-miR-548u	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17500595, 32296183, 32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005758	Component	Mitochondrial intermembrane space	TAS
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	2849755
GO:0006119	Process	Oxidative phosphorylation	IEA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	NAS	30030519
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	30030519
GO:0045277	Component	Respiratory chain complex IV	IEA
GO:0045333	Process	Cellular respiration	NAS	30030519

MIM	HGNC	e!Ensembl
124090	2285	ENSG00000164919

Protein

UniProt ID

P09669

Protein name

Cytochrome c oxidase subunit 6C (Cytochrome c oxidase polypeptide VIc)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02937	COX6C	5 → 74	Cytochrome c oxidase subunit VIc	Family

Sequence

MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

COX6C (cytochrome c oxidase subunit 6C)