Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1345
Gene name	Cytochrome c oxidase subunit 6C
Gene symbol	COX6C
Synonyms (NCBI Gene)	-
Chromosome	8
Chromosome location	8q22.2
Summary	Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multip

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments
MIRT905493	hsa-miR-2053	CLIP-seq
MIRT905494	hsa-miR-3125	CLIP-seq
MIRT905495	hsa-miR-3185	CLIP-seq
MIRT905496	hsa-miR-335	CLIP-seq
MIRT905497	hsa-miR-3607-5p	CLIP-seq
MIRT905498	hsa-miR-3916	CLIP-seq
MIRT905499	hsa-miR-3928	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT905501	hsa-miR-4276	CLIP-seq
MIRT905502	hsa-miR-4504	CLIP-seq
MIRT905503	hsa-miR-4697-3p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905505	hsa-miR-4731-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT905507	hsa-miR-4801	CLIP-seq
MIRT905508	hsa-miR-569	CLIP-seq
MIRT905509	hsa-miR-592	CLIP-seq
MIRT905510	hsa-miR-597	CLIP-seq
MIRT905511	hsa-miR-664	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905494	hsa-miR-3125	CLIP-seq
MIRT905496	hsa-miR-335	CLIP-seq
MIRT905498	hsa-miR-3916	CLIP-seq
MIRT905499	hsa-miR-3928	CLIP-seq
MIRT905494	hsa-miR-3125	CLIP-seq
MIRT905496	hsa-miR-335	CLIP-seq
MIRT905497	hsa-miR-3607-5p	CLIP-seq
MIRT905498	hsa-miR-3916	CLIP-seq
MIRT905499	hsa-miR-3928	CLIP-seq
MIRT1968511	hsa-miR-3973	CLIP-seq
MIRT905501	hsa-miR-4276	CLIP-seq
MIRT905502	hsa-miR-4504	CLIP-seq
MIRT1968512	hsa-miR-4693-5p	CLIP-seq
MIRT905503	hsa-miR-4697-3p	CLIP-seq
MIRT905505	hsa-miR-4731-3p	CLIP-seq
MIRT905507	hsa-miR-4801	CLIP-seq
MIRT1968513	hsa-miR-548l	CLIP-seq
MIRT905509	hsa-miR-592	CLIP-seq
MIRT905510	hsa-miR-597	CLIP-seq
MIRT905511	hsa-miR-664	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905497	hsa-miR-3607-5p	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT905501	hsa-miR-4276	CLIP-seq
MIRT905502	hsa-miR-4504	CLIP-seq
MIRT905503	hsa-miR-4697-3p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905505	hsa-miR-4731-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT905507	hsa-miR-4801	CLIP-seq
MIRT905509	hsa-miR-592	CLIP-seq
MIRT905510	hsa-miR-597	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905511	hsa-miR-664	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905493	hsa-miR-2053	CLIP-seq
MIRT905495	hsa-miR-3185	CLIP-seq
MIRT1968511	hsa-miR-3973	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT1968512	hsa-miR-4693-5p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT2507897	hsa-miR-539	CLIP-seq
MIRT1968513	hsa-miR-548l	CLIP-seq
MIRT2507898	hsa-miR-548u	CLIP-seq
MIRT905508	hsa-miR-569	CLIP-seq
MIRT905495	hsa-miR-3185	CLIP-seq
MIRT1968511	hsa-miR-3973	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT1968512	hsa-miR-4693-5p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT2507897	hsa-miR-539	CLIP-seq
MIRT1968513	hsa-miR-548l	CLIP-seq
MIRT2507898	hsa-miR-548u	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17500595, 32296183, 32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005758	Component	Mitochondrial intermembrane space	TAS
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	2849755
GO:0006119	Process	Oxidative phosphorylation	IEA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	NAS	30030519
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	30030519
GO:0045277	Component	Respiratory chain complex IV	IEA
GO:0045333	Process	Cellular respiration	NAS	30030519

MIM	HGNC	e!Ensembl
124090	2285	ENSG00000164919

P09669

Protein name

Cytochrome c oxidase subunit 6C (Cytochrome c oxidase polypeptide VIc)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02937	COX6C	5 → 74	Cytochrome c oxidase subunit VIc	Family

Sequence

MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma Follicular	Associate	27283500	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	38242874	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	33318294	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	36594618, 37510369	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Associate	38242874	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	34623759	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	33083497	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	38196829	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fused Kidney	Associate	38242874	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Associate	36451838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	34714849	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Stimulate	38242874	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	34623759, 36551283	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	27283500, 36594618	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Inhibit	24204994	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	37482618	★★★★★ ★☆☆☆☆ Found in Text Mining only

COX6C (cytochrome c oxidase subunit 6C)