Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	134288
Gene name	Transmembrane protein 174
Gene symbol	TMEM174
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q13.2

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT724005	hsa-miR-3184-3p	HITS-CLIP	19536157
MIRT724004	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT724003	hsa-miR-4330	HITS-CLIP	19536157
MIRT724002	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT724001	hsa-miR-4261	HITS-CLIP	19536157
MIRT711147	hsa-miR-1207-3p	HITS-CLIP	19536157
MIRT711146	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT711145	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT711144	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT711143	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT711142	hsa-miR-2861	HITS-CLIP	19536157
MIRT711141	hsa-miR-670-5p	HITS-CLIP	19536157
MIRT711140	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT711139	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711138	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711137	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT724005	hsa-miR-3184-3p	HITS-CLIP	19536157
MIRT724004	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT724003	hsa-miR-4330	HITS-CLIP	19536157
MIRT724002	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT724001	hsa-miR-4261	HITS-CLIP	19536157
MIRT711147	hsa-miR-1207-3p	HITS-CLIP	19536157
MIRT711146	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT711145	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT711144	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT711143	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT711142	hsa-miR-2861	HITS-CLIP	19536157
MIRT711141	hsa-miR-670-5p	HITS-CLIP	19536157
MIRT711140	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT711139	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT711138	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT711137	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT1432799	hsa-miR-15a	CLIP-seq
MIRT1432800	hsa-miR-15b	CLIP-seq
MIRT1432801	hsa-miR-16	CLIP-seq
MIRT1432802	hsa-miR-195	CLIP-seq
MIRT1432803	hsa-miR-219-1-3p	CLIP-seq
MIRT1432804	hsa-miR-3122	CLIP-seq
MIRT1432805	hsa-miR-3174	CLIP-seq
MIRT1432806	hsa-miR-3606	CLIP-seq
MIRT1432807	hsa-miR-3913-5p	CLIP-seq
MIRT1432808	hsa-miR-3925-5p	CLIP-seq
MIRT1432809	hsa-miR-424	CLIP-seq
MIRT1432810	hsa-miR-450b-3p	CLIP-seq
MIRT1432811	hsa-miR-4682	CLIP-seq
MIRT1432812	hsa-miR-4773	CLIP-seq
MIRT1432813	hsa-miR-497	CLIP-seq
MIRT1432814	hsa-miR-571	CLIP-seq
MIRT1432815	hsa-miR-769-3p	CLIP-seq
MIRT1432816	hsa-miR-921	CLIP-seq
MIRT2129769	hsa-miR-1224-3p	CLIP-seq
MIRT2129770	hsa-miR-1260	CLIP-seq
MIRT2129771	hsa-miR-1260b	CLIP-seq
MIRT2129772	hsa-miR-1280	CLIP-seq
MIRT2129773	hsa-miR-4431	CLIP-seq
MIRT1432812	hsa-miR-4773	CLIP-seq
MIRT2644909	hsa-miR-1208	CLIP-seq
MIRT1432799	hsa-miR-15a	CLIP-seq
MIRT1432800	hsa-miR-15b	CLIP-seq
MIRT1432801	hsa-miR-16	CLIP-seq
MIRT1432802	hsa-miR-195	CLIP-seq
MIRT1432809	hsa-miR-424	CLIP-seq
MIRT1432813	hsa-miR-497	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	20331980
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0055062	Process	Phosphate ion homeostasis	IEA
GO:0055062	Process	Phosphate ion homeostasis	ISS

MIM	HGNC	e!Ensembl
614909	28187	ENSG00000164325

Q8WUU8

Protein name

Transmembrane protein 174

Protein function

Regulator of plasma phosphate homeostasis. Decreases serum inorganic phosphate (Pi) uptake by regulating the sodium-phosphate cotransporter SLC34A1 trafficking by PTH and FGF23 in the kidney.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15029	TMEM174	9 → 241	Transmembrane protein 174	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in kidney (PubMed:20331980). Selectively localized in the apical membrane of renal proximal tubule epithelial cells (PubMed:35459732). {ECO:0000269|PubMed:20331980, ECO:0000269|PubMed:35459732}.

Sequence

MEQGSGRLEDFPVNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWI
KYQGVSHFEWTQLLGPVLLSVGVTFILIAVCKFKMLSCQLCKESEERVPDSEQTPGGPSF
VFTGINQPITFHGATVVQYIPPPYGSPEPMGINTSYLQSVVSPCGLITSGGAAAAMSSPP
QYYTIYPQDNSAFVVDEGCLSFTDGGNHRPNPDVDQLEETQLEEEACACFSPPPYEEIYS
LPR

Sequence length

243

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC GRAFT VERSUS HOST DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TMEM174 (transmembrane protein 174)