IL31RA (interleukin 31 receptor A)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
133396
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 31 receptor A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL31RA
Synonyms (NCBI Gene) Gene synonyms aliases
CRL, CRL3, GLM-R, GLMR, GPL, IL-31RA, PLCA2, PRO21384, hGLM-R, zcytoR17
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PLCA2
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the type I cytokine receptor family. This receptor, with homology to gp130, is expressed on monocytes, and is involved in IL-31 signaling via activation of STAT-3 and STAT-5. It functions either as a monomer, or
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
SNP ID Visualize variation Clinical significance Consequence
rs1561123748 C>T Pathogenic Coding sequence variant, missense variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(7)
miRTarBase ID miRNA Experiments Reference
MIRT019063 hsa-miR-335-5p Microarray 18185580
MIRT1550119 hsa-miR-4660 CLIP-seq
MIRT1550120 hsa-miR-885-3p CLIP-seq
MIRT1550119 hsa-miR-4660 CLIP-seq
MIRT1550120 hsa-miR-885-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(30)
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade NAS 11877449
GO:0002067 Process Glandular epithelial cell differentiation IEA
GO:0002438 Process Acute inflammatory response to antigenic stimulus IEA
GO:0003713 Function Transcription coactivator activity NAS 11877449
GO:0004896 Function Cytokine receptor activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
609510 18969 ENSG00000164509
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q8NI17
Protein name Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
Protein function Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5 (PubMed:11877449, PubMed:14504285, PubMed:15194700, PubMed:15627637). May function in skin immunity (PubMed:15184896). Mediates
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09240 IL6Ra-bind 27 → 119 Interleukin-6 receptor alpha chain, binding Domain
PF00041 fn3 123 → 215 Fibronectin type III domain Domain
PF00041 fn3 425 → 507 Fibronectin type III domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in CD14- and CD56-positive blood cells (PubMed:11877449). Expressed in macrophages (PubMed:16461143, PubMed:18439099). Expressed in keratinocytes (PubMed:21261663). Expressed in a subset of dorsal root ganglia neurons (at pro
Sequence 
MMWTWALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYA
FGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIA
KTEPPKIFRVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRK
DKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAE
ADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWV
SMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWF
PDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGV
PSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYG
LESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVA
YGLKKPNKLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPS
DKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVS
PEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLCEEGAPNPYLKNSVTAREFLV
SEKLPEHTKGEV
Sequence length 732
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway 		  IL-6-type cytokine receptor ligand interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Amyloidosis Amyloidosis, Primary Cutaneous, AMYLOIDOSIS, PRIMARY LOCALIZED CUTANEOUS, 2, AMYLOIDOSIS, PRIMARY LOCALIZED CUTANEOUS, 1 rs63750567, rs63750560, rs387906821, rs387906822, rs387906823, rs1561123748, rs140352180, rs770211260, rs763065333, rs1554300664, rs747723062, rs773435101 19690585
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Localized Cutaneous Amyloidosis familial primary localized cutaneous amyloidosis GenCC
Show/Hide Text Mining Associations (13)
Associations from Text Mining
Disease Name Relationship Type References
Amyloidosis Primary Cutaneous Associate 19690585
Asthma Associate 26956917, 35606283
Carcinoma Hepatocellular Associate 36685508
Death Associate 39523440
Dermatomyositis Associate 29494763
Endometrial Neoplasms Associate 38108937
Inflammation Associate 22041865
Lymphoma T Cell Cutaneous Associate 27001482
Neoplasms Associate 27906189, 36359832, 39523440
Neuroblastoma Associate 21436895, 23222812