Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	133396
Gene name	Interleukin 31 receptor A
Gene symbol	IL31RA
Synonyms (NCBI Gene)	CRLCRL3GLM-RGLMRGPLIL-31RAPLCA2PRO21384hGLM-RzcytoR17
Chromosome	5
Chromosome location	5q11.2
Summary	The protein encoded by this gene belongs to the type I cytokine receptor family. This receptor, with homology to gp130, is expressed on monocytes, and is involved in IL-31 signaling via activation of STAT-3 and STAT-5. It functions either as a monomer, or

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1561123748	C>T	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant

Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019063	hsa-miR-335-5p	Microarray	18185580
MIRT1550119	hsa-miR-4660	CLIP-seq
MIRT1550120	hsa-miR-885-3p	CLIP-seq
MIRT1550119	hsa-miR-4660	CLIP-seq
MIRT1550120	hsa-miR-885-3p	CLIP-seq
MIRT1550119	hsa-miR-4660	CLIP-seq
MIRT1550120	hsa-miR-885-3p	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	NAS	11877449
GO:0002067	Process	Glandular epithelial cell differentiation	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002438	Process	Acute inflammatory response to antigenic stimulus	IEA
GO:0003713	Function	Transcription coactivator activity	NAS	11877449
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	TAS	11877449
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006952	Process	Defense response	NAS	11877449
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	NAS	11877449
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEP	11877449
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11877449
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11877449
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS	11877449
GO:0019901	Function	Protein kinase binding	NAS	11877449
GO:0019955	Function	Cytokine binding	IBA
GO:0019955	Function	Cytokine binding	IEA
GO:0019955	Function	Cytokine binding	NAS	11877449
GO:0030154	Process	Cell differentiation	IEA
GO:0030224	Process	Monocyte differentiation	IEP	11877449
GO:0030225	Process	Macrophage differentiation	NAS	11877449
GO:0030424	Component	Axon	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IEP	11877449
GO:0042592	Process	Homeostatic process	NAS	11877449
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043031	Process	Negative regulation of macrophage activation	NAS	11877449
GO:0043066	Process	Negative regulation of apoptotic process	NAS	11877449
GO:0043235	Component	Receptor complex	IBA
GO:0045202	Component	Synapse	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	11877449
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IEA
GO:0098542	Process	Defense response to other organism	IEA

MIM	HGNC	e!Ensembl
609510	18969	ENSG00000164509

Q8NI17

Protein name

Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)

Protein function

Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5 (PubMed:11877449, PubMed:14504285, PubMed:15194700, PubMed:15627637). May function in skin immunity (PubMed:15184896). Mediates

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09240	IL6Ra-bind	27 → 119	Interleukin-6 receptor alpha chain, binding	Domain
PF00041	fn3	123 → 215	Fibronectin type III domain	Domain
PF00041	fn3	425 → 507	Fibronectin type III domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in CD14- and CD56-positive blood cells (PubMed:11877449). Expressed in macrophages (PubMed:16461143, PubMed:18439099). Expressed in keratinocytes (PubMed:21261663). Expressed in a subset of dorsal root ganglia neurons (at pro

Sequence

MMWTWALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYA
FGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIA
KTEPPKIFRVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRK
DKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAE
ADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWV
SMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWF
PDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGV
PSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYG
LESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVA
YGLKKPNKLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPS
DKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVS
PEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLCEEGAPNPYLKNSVTAREFLV
SEKLPEHTKGEV

Sequence length

732

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway		IL-6-type cytokine receptor ligand interactions

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Amyloidosis, primary localized cutaneous, 2	Pathogenic	rs1561123748	RCV000023775

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs148721785	RCV005935394
Familial pancreatic carcinoma	Benign	rs148721785	RCV005935395
IL31RA-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	rs9632389, rs17701253, rs74629680, rs544735425, rs371900126, rs148721785, rs161704, rs59086632, rs183184063, rs144829917, rs73118479	RCV003973266 RCV003914191 RCV003911868 RCV003944028 RCV003939626 RCV003979188 RCV003982157 RCV003976676 RCV003966817 RCV003950738 RCV003916224
Malignant lymphoma, large B-cell, diffuse	Benign	rs16884641, rs148721785	RCV005920620 RCV005935396
Melanoma	Benign	rs148721785	RCV005935399
Ovarian serous cystadenocarcinoma	Likely benign; Benign	rs371988926, rs148721785	RCV005930902 RCV005935398
Sarcoma	Benign	rs148721785	RCV005935397
Uterine carcinosarcoma	Benign	rs16884641	RCV005920621

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Amyloidosis Primary Cutaneous	Associate	19690585
Asthma	Associate	26956917, 35606283
Carcinoma Hepatocellular	Associate	36685508
Death	Associate	39523440
Dermatomyositis	Associate	29494763
Endometrial Neoplasms	Associate	38108937
Inflammation	Associate	22041865
Lymphoma T Cell Cutaneous	Associate	27001482
Neoplasms	Associate	27906189, 36359832, 39523440
Neuroblastoma	Associate	21436895, 23222812
Osteogenesis Imperfecta	Associate	2981843
Overweight	Associate	30524658
Pruritus	Associate	22041865, 27001482

IL31RA (interleukin 31 receptor A)