Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	133022
Gene name	Translocation associated membrane protein 1 like 1
Gene symbol	TRAM1L1
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4q26

Show/Hide all (14)

miRTarBase ID	miRNA	Experiments
MIRT1921752	hsa-miR-105	CLIP-seq
MIRT1921752	hsa-miR-105	CLIP-seq
MIRT1923030	hsa-miR-500a	CLIP-seq
MIRT2649762	hsa-miR-1305	CLIP-seq
MIRT2649763	hsa-miR-185	CLIP-seq
MIRT2649764	hsa-miR-330-3p	CLIP-seq
MIRT2649765	hsa-miR-4306	CLIP-seq
MIRT2649766	hsa-miR-4644	CLIP-seq
MIRT2649767	hsa-miR-4786-5p	CLIP-seq
MIRT2649768	hsa-miR-4789-3p	CLIP-seq
MIRT2649769	hsa-miR-607	CLIP-seq
MIRT2649764	hsa-miR-330-3p	CLIP-seq
MIRT2649768	hsa-miR-4789-3p	CLIP-seq
MIRT2694091	hsa-miR-494	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006616	Process	SRP-dependent cotranslational protein targeting to membrane, translocation	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0045048	Process	Protein insertion into ER membrane	IBA

MIM	HGNC	e!Ensembl
617505	28371	ENSG00000174599

Q8N609

Protein name

Translocating chain-associated membrane protein 1-like 1

Protein function

Stimulatory or required for the translocation of secretory proteins across the ER membrane.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08390	TRAM1	47 → 115	TRAM1-like protein	Family
PF03798	TRAM_LAG1_CLN8	118 → 317	TLC domain	Domain

Sequence

MGLRKKSTKNPPVLSQEFILQNHADIVSCVGMFFLLGLVFEGTAEASIVFLTLQHSVAVP
AAEEQATGSKSLYYYGVKDLATVFFYMLVAIIIHATIQEYVLDKINKRMQFTKAKQNKFN
ESGQFSVFYFFSCIWGTFILISENCLSDPTLIWKARPHSMMTFQMKFFYISQLAYWFHAF
PELYFQKTKKQDIPRQLVYIGLHLFHITGAYLLYLNHLGLLLLVLHYFVELLSHMCGLFY
FSDEKYQKGISLWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAV
LSSSCTIQAYVTWNLITLWLQRWVEDSNIQASCMKKKRSRSSKKRTENGVGVETSNRVDC
PPKRKEKSS

Sequence length

369

Interactions

View interactions

	KEGG
	Protein processing in endoplasmic reticulum

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRONCHOPULMONARY DYSPLASIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Embryonal	Associate	36713456	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRAM1L1 (translocation associated membrane protein 1 like 1)