Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1329
Gene name Gene Name - the full gene name approved by the HGNC.	Cytochrome c oxidase subunit 5B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	COX5B
Synonyms (NCBI Gene) Gene synonyms aliases	COXVB
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q11.2
Summary Summary of gene provided in NCBI Entrez Gene.	Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradien

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT564388	hsa-miR-3120-3p	PAR-CLIP	20371350
MIRT564387	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT564386	hsa-miR-8081	PAR-CLIP	20371350
MIRT207609	hsa-miR-8055	PAR-CLIP	20371350
MIRT564388	hsa-miR-3120-3p	PAR-CLIP	20371350
MIRT564387	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT564386	hsa-miR-8081	PAR-CLIP	20371350
MIRT207609	hsa-miR-8055	PAR-CLIP	20371350
MIRT905399	hsa-miR-1243	CLIP-seq
MIRT905400	hsa-miR-130a	CLIP-seq
MIRT905401	hsa-miR-130b	CLIP-seq
MIRT905402	hsa-miR-301a	CLIP-seq
MIRT905403	hsa-miR-301b	CLIP-seq
MIRT905404	hsa-miR-3591-5p	CLIP-seq
MIRT905405	hsa-miR-3654	CLIP-seq
MIRT905406	hsa-miR-3666	CLIP-seq
MIRT905407	hsa-miR-3978	CLIP-seq
MIRT905408	hsa-miR-4295	CLIP-seq
MIRT905409	hsa-miR-4434	CLIP-seq
MIRT905410	hsa-miR-4473	CLIP-seq
MIRT905411	hsa-miR-4516	CLIP-seq
MIRT905412	hsa-miR-454	CLIP-seq
MIRT905413	hsa-miR-4671-3p	CLIP-seq
MIRT905414	hsa-miR-875-3p	CLIP-seq
MIRT905399	hsa-miR-1243	CLIP-seq
MIRT905400	hsa-miR-130a	CLIP-seq
MIRT905401	hsa-miR-130b	CLIP-seq
MIRT905402	hsa-miR-301a	CLIP-seq
MIRT905403	hsa-miR-301b	CLIP-seq
MIRT905404	hsa-miR-3591-5p	CLIP-seq
MIRT905405	hsa-miR-3654	CLIP-seq
MIRT905406	hsa-miR-3666	CLIP-seq
MIRT905407	hsa-miR-3978	CLIP-seq
MIRT905408	hsa-miR-4295	CLIP-seq
MIRT905409	hsa-miR-4434	CLIP-seq
MIRT905410	hsa-miR-4473	CLIP-seq
MIRT905411	hsa-miR-4516	CLIP-seq
MIRT905412	hsa-miR-454	CLIP-seq
MIRT905413	hsa-miR-4671-3p	CLIP-seq
MIRT905414	hsa-miR-875-3p	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004129	Function	Cytochrome-c oxidase activity	IEA
GO:0005515	Function	Protein binding	IPI	17500595, 21516116, 25416956, 31170524, 31515488, 32296183, 32814053
GO:0005739	Component	Mitochondrion	IDA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	IBA	21873635
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	TAS
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	TAS	1646156
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
123866	2269	ENSG00000135940

Protein

UniProt ID

P10606

Protein name

Cytochrome c oxidase subunit 5B, mitochondrial (Cytochrome c oxidase polypeptide Vb)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01215	COX5B	8 → 128	Cytochrome c oxidase subunit Vb	Domain

Sequence

MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLD
PYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHY
KLVPQQLAH

Sequence length

129

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

COX5B (cytochrome c oxidase subunit 5B)