Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
132864
Gene name Gene Name - the full gene name approved by the HGNC.
Cytoplasmic polyadenylation element binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CPEB2
Synonyms (NCBI Gene) Gene synonyms aliases
CPE-BP2, CPEB-2, hCPEB-2
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003167 hsa-miR-210-3p immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR 19826008
MIRT005587 hsa-miR-26a-5p Luciferase reporter assay, Northern blot, qRT-PCR 20660482
MIRT005587 hsa-miR-26a-5p Luciferase reporter assay, Northern blot, qRT-PCR 20660482
MIRT005590 hsa-miR-92a-3p Luciferase reporter assay, Northern blot, qRT-PCR 20660482
MIRT005590 hsa-miR-92a-3p Luciferase reporter assay, Northern blot, qRT-PCR 20660482
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000900 Function MRNA regulatory element binding translation repressor activity IBA
GO:0000900 Function MRNA regulatory element binding translation repressor activity ISS
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610605 21745 ENSG00000137449
Protein
UniProt ID Q7Z5Q1
Protein name Cytoplasmic polyadenylation element-binding protein 2 (CPE-BP2) (CPE-binding protein 2) (hCPEB-2)
Protein function May play a role in translational regulation of stored mRNAs in transcriptionally inactive haploid spermatids. Binds to poly(U) RNA oligomers (By similarity). Required for cell cycle progression, specifically for the transition from metaphase to
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16367 RRM_7 331 420 RNA recognition motif Domain
PF16366 CEBP_ZZ 513 576 Cytoplasmic polyadenylation element-binding protein ZZ domain Domain
Sequence
MPPPSPDSENGFYPGLPSSMNPAFFPSFSPVSPHGCTGLSVPTSGGGGGGFGGPFSATAV
PPPPPPAMNIPQQQPPPPAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQPLL
KQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKF
TRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRID
QDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRSSLFPIDDGL
LDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVV
DWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRP

WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKY
PKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFA
PFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKE
GADRPRQIHFRWN
Sequence length 589
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Oocyte meiosis
Progesterone-mediated oocyte maturation
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 32440535, 34908514
Diabetes Mellitus Associate 33479058
Diabetes Mellitus Type 2 Associate 33479058
Glioma Associate 27256982
Multiple Myeloma Associate 37231521
Nasopharyngeal Carcinoma Associate 28358263
Nasopharyngeal Neoplasms Associate 28358263
Neoplasm Metastasis Associate 28904175, 31138601
Neoplasms Associate 28904175
Triple Negative Breast Neoplasms Associate 31138601