Gene Gene information from NCBI Gene database.
Entrez ID 132671
Gene name Spermatogenesis associated 18
Gene symbol SPATA18
Synonyms (NCBI Gene)
MieapSPETEX1
Chromosome 4
Chromosome location 4q12
Summary This gene encodes a p53-inducible protein that is able to induce lysosome-like organelles within mitochondria that eliminate oxidized mitochondrial proteins, thereby contributing to mitochondrial quality control. Dysregulation of mitochondrial quality con
miRNA miRNA information provided by mirtarbase database.
197
miRTarBase ID miRNA Experiments Reference
MIRT017774 hsa-miR-335-5p Microarray 18185580
MIRT545174 hsa-miR-6888-5p PAR-CLIP 21572407
MIRT545172 hsa-miR-3938 PAR-CLIP 21572407
MIRT545171 hsa-miR-4768-3p PAR-CLIP 21572407
MIRT545170 hsa-miR-665 PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21264221, 22292033, 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IDA 21264221, 21264228
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612814 29579 ENSG00000163071
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TC71
Protein name Mitochondria-eating protein (Spermatogenesis-associated protein 18)
Protein function Key regulator of mitochondrial quality that mediates the repairing or degradation of unhealthy mitochondria in response to mitochondrial damage (PubMed:21264221, PubMed:21264228, PubMed:22292033, PubMed:22532927). Mediator of mitochondrial prote
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16026 MIEAP 298 486 Mitochondria-eating protein Family
Sequence
MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTA
AAQEGGRNDGVETIKSRLLPWLEASFTAASLGKSVDSKVPSLQDTFDRERHKDPSPRDRD
MQQLDSNLNSTRSQCNQVQDDLVETEKNLEESKNRSAISLLAAEEEINQLKKQLKSLQAQ
EDARHRNTDQRSSENRRSEPWSLEERKREQWNSLKQNADQQDTEAMSDYKKQLRNLKEEI
AVLSAEKSALQGRSSRSRSPSPAPRSRSCSRSRSASPSTAVKVRRPSPNRSKLSNVARKA
ALLSRFSDSYSQARLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAFRHFKIHVRKS
LTPSYVGSNDFENAVLDYVICHLDLYDSQSSVNDVIRAMNVNPKISFPPVVDFCLLSDFI
QEICCIAFAMQALEPPLDIAYGADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCV
IMKGEA
VTRRGAFWNSVRSVSRCRSRSLSPICPRSQIGLNTMSRSRSPSPIRCGLPRF
Sequence length 538
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193921037 RCV000149345
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 38183982
Adenoma Associate 28058013
Breast Neoplasms Associate 30290054
Carcinoma Ductal Associate 30290054
Carcinoma Renal Cell Stimulate 36751118
Colorectal Neoplasms Associate 30290054, 35269894
Esophageal Neoplasms Associate 32736677
Gastrointestinal Neoplasms Associate 32736677
Lymphatic Metastasis Associate 35269894
Mitochondrial Diseases Associate 21264221