Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	132204
Gene name Gene Name - the full gene name approved by the HGNC.	Synaptoporin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SYNPR
Synonyms (NCBI Gene) Gene synonyms aliases	SPO
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p14.2

Show/Hide all(20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017484	hsa-miR-335-5p	Microarray	18185580
MIRT052365	hsa-let-7a-5p	CLASH	23622248
MIRT050282	hsa-miR-25-3p	CLASH	23622248
MIRT049284	hsa-miR-92a-3p	CLASH	23622248
MIRT037207	hsa-miR-877-5p	CLASH	23622248
MIRT036821	hsa-miR-877-3p	CLASH	23622248
MIRT1406714	hsa-miR-186	CLIP-seq
MIRT1406715	hsa-miR-3161	CLIP-seq
MIRT1406716	hsa-miR-3973	CLIP-seq
MIRT1406717	hsa-miR-450b-5p	CLIP-seq
MIRT1406718	hsa-miR-4762-3p	CLIP-seq
MIRT1406719	hsa-miR-4775	CLIP-seq
MIRT1406720	hsa-miR-489	CLIP-seq
MIRT1406721	hsa-miR-518a-5p	CLIP-seq
MIRT1406722	hsa-miR-526b	CLIP-seq
MIRT1406723	hsa-miR-527	CLIP-seq
MIRT1406724	hsa-miR-548l	CLIP-seq
MIRT1406725	hsa-miR-578	CLIP-seq
MIRT1406726	hsa-miR-590-3p	CLIP-seq
MIRT2121959	hsa-miR-3591-3p	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 33961781
GO:0008021	Component	Synaptic vesicle	IEA
GO:0016020	Component	Membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0045202	Component	Synapse	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q8TBG9

Protein name

Synaptoporin

Protein function

Intrinsic membrane protein of small synaptic vesicles. Probable vesicular channel protein (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01284	MARVEL	2 → 196	Membrane-associating domain	Domain

Sequence

MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPT
CEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV
TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSV
VFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQ
QASLGPTSDEFGQQPTGPTSFTNQI

Sequence length

265

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	31638248
Bipolar Disorder	Associate	32339108
Carcinoma Non Small Cell Lung	Associate	31638248
Left sided gallbladder	Associate	25138779
Leukoencephalopathies	Associate	22745009
Neoplasms	Associate	33157921
Neuralgia	Associate	39674387
Pain	Associate	39674387
Psychotic Disorders	Associate	32339108
Thyroid Cancer Papillary	Associate	33157921

SYNPR (synaptoporin)