RTP1 (receptor transporter protein 1)

Gene

• Entrez ID: 132112
• Gene name: Receptor transporter protein 1
• Gene symbol: RTP1
• Synonyms (NCBI Gene): Z3CXXC1
• Chromosome: 3
• Chromosome location: 3q27.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017895	hsa-miR-335-5p	Microarray	18185580
MIRT1322361	hsa-miR-1303	CLIP-seq
MIRT1322362	hsa-miR-2355-5p	CLIP-seq
MIRT1322363	hsa-miR-3180-5p	CLIP-seq
MIRT1322364	hsa-miR-4312	CLIP-seq
MIRT1322365	hsa-miR-4325	CLIP-seq
MIRT1322366	hsa-miR-4477b	CLIP-seq
MIRT1322367	hsa-miR-4735-5p	CLIP-seq
MIRT1322368	hsa-miR-520a-5p	CLIP-seq
MIRT1322369	hsa-miR-525-5p	CLIP-seq
MIRT2095665	hsa-miR-1207-5p	CLIP-seq
MIRT2095666	hsa-miR-1909	CLIP-seq
MIRT2095667	hsa-miR-3184	CLIP-seq
MIRT2095668	hsa-miR-423-5p	CLIP-seq
MIRT2095669	hsa-miR-4251	CLIP-seq
MIRT2095670	hsa-miR-4663	CLIP-seq
MIRT2095671	hsa-miR-4686	CLIP-seq
MIRT2095672	hsa-miR-4688	CLIP-seq
MIRT1322367	hsa-miR-4735-5p	CLIP-seq
MIRT2095673	hsa-miR-4763-3p	CLIP-seq
MIRT2095674	hsa-miR-486-3p	CLIP-seq
MIRT2095675	hsa-miR-580	CLIP-seq
MIRT2393951	hsa-miR-4272	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006612	Process	Protein targeting to membrane	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	15550249
GO:0016020	Component	Membrane	IEA
GO:0031849	Function	Olfactory receptor binding	IBA
GO:0031849	Function	Olfactory receptor binding	IMP	15550249
GO:0046872	Function	Metal ion binding	IEA
GO:0051205	Process	Protein insertion into membrane	IBA
GO:0051205	Process	Protein insertion into membrane	IDA	15550249

Other IDs

• MIM: 609137
• HGNC: 28580
• e!Ensembl: ENSG00000175077

Protein

• UniProt ID: P59025
• Protein name: Receptor-transporting protein 1 (3CxxC-type zinc finger protein 1)
• Protein function: Specifically promotes functional cell surface expression of olfactory receptors, but not of other GPCRs.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13695	zf-3CxxC	87 → 197	Zinc-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:16720576}.
• Sequence:

  MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPA
  DSWDLIIDPNLKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRA
  GSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASR
  QDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTKSQDQTGSGWNFCSIP
  WCLFWATVLLLIIYLQFSFRSSV

• Sequence length: 263

Pathways

Reactome:

Olfactory Signaling Pathway