Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	132112
Gene name Gene Name - the full gene name approved by the HGNC.	Receptor transporter protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RTP1
Synonyms (NCBI Gene) Gene synonyms aliases	Z3CXXC1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q27.3

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017895	hsa-miR-335-5p	Microarray	18185580
MIRT1322361	hsa-miR-1303	CLIP-seq
MIRT1322362	hsa-miR-2355-5p	CLIP-seq
MIRT1322363	hsa-miR-3180-5p	CLIP-seq
MIRT1322364	hsa-miR-4312	CLIP-seq
MIRT1322365	hsa-miR-4325	CLIP-seq
MIRT1322366	hsa-miR-4477b	CLIP-seq
MIRT1322367	hsa-miR-4735-5p	CLIP-seq
MIRT1322368	hsa-miR-520a-5p	CLIP-seq
MIRT1322369	hsa-miR-525-5p	CLIP-seq
MIRT2095665	hsa-miR-1207-5p	CLIP-seq
MIRT2095666	hsa-miR-1909	CLIP-seq
MIRT2095667	hsa-miR-3184	CLIP-seq
MIRT2095668	hsa-miR-423-5p	CLIP-seq
MIRT2095669	hsa-miR-4251	CLIP-seq
MIRT2095670	hsa-miR-4663	CLIP-seq
MIRT2095671	hsa-miR-4686	CLIP-seq
MIRT2095672	hsa-miR-4688	CLIP-seq
MIRT1322367	hsa-miR-4735-5p	CLIP-seq
MIRT2095673	hsa-miR-4763-3p	CLIP-seq
MIRT2095674	hsa-miR-486-3p	CLIP-seq
MIRT2095675	hsa-miR-580	CLIP-seq
MIRT2393951	hsa-miR-4272	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA	21873635
GO:0005886	Component	Plasma membrane	IEA
GO:0006612	Process	Protein targeting to membrane	IBA	21873635
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	IDA	15550249
GO:0016021	Component	Integral component of membrane	IEA
GO:0031849	Function	Olfactory receptor binding	IBA	21873635
GO:0031849	Function	Olfactory receptor binding	IMP	15550249
GO:0051205	Process	Protein insertion into membrane	IBA	21873635
GO:0051205	Process	Protein insertion into membrane	IDA	15550249

MIM	HGNC	e!Ensembl
609137	28580	ENSG00000175077

Protein

UniProt ID

P59025

Protein name

Receptor-transporting protein 1 (3CxxC-type zinc finger protein 1)

Protein function

Specifically promotes functional cell surface expression of olfactory receptors, but not of other GPCRs.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13695	zf-3CxxC	87 → 197	Zinc-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:16720576}.

Sequence

MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPA
DSWDLIIDPNLKHNVLSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRA
GSVRMRVFKQLCYECGTARLDESSMLEENIEGLVDNLITSLREQCYGERGGQYRIHVASR
QDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTKSQDQTGSGWNFCSIP
WCLFWATVLLLIIYLQFSFRSSV

Sequence length

263

Interactions

View interactions

	Reactome
			Olfactory Signaling Pathway

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining
Brain Diseases	Associate	28325891
Epilepsy	Associate	28325891
Oropharyngeal Neoplasms	Associate	35459784
Xerostomia	Associate	35459784

RTP1 (receptor transporter protein 1)