Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
131965
Gene name Gene Name - the full gene name approved by the HGNC.
Methyltransferase 6, tRNA N3-cytidine
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
METTL6
Synonyms (NCBI Gene) Gene synonyms aliases
hMETTL6
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p25.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052628 hsa-let-7a-5p CLASH 23622248
MIRT486617 hsa-miR-6783-5p PAR-CLIP 23592263
MIRT486616 hsa-miR-637 PAR-CLIP 23592263
MIRT486615 hsa-miR-3150b-3p PAR-CLIP 23592263
MIRT486613 hsa-miR-4784 PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 34268557
GO:0005634 Component Nucleus IDA 34268557
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 34268557
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618903 28343 ENSG00000206562
Protein
UniProt ID Q8TCB7
Protein name tRNA N(3)-cytidine methyltransferase METTL6 (EC 2.1.1.-) (Methyltransferase-like protein 6) (hMETTL6)
Protein function S-adenosyl-L-methionine-dependent methyltransferase that mediates N(3)-methylcytidine modification of residue 32 of the tRNA anticodon loop of tRNA(Ser), including tRNA(Ser)(UGA) and tRNA(Ser)(GCU) (PubMed:32923617, PubMed:34268557, PubMed:34862
PDB 7EZG , 7F1E , 8OWX , 8OWY , 8P7B , 8P7C , 8P7D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08242 Methyltransf_12 84 183 Methyltransferase domain Domain
Sequence
MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDR
HWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVK
QNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLK
PGK
SVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVV
NEYVFRETVNKKEGLCVPRVFLQSKFLKPPKNPSPVVLGLDPKS
Sequence length 284
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 25151356
Carcinoma Hepatocellular Associate 34913069, 36341373
Glioblastoma Associate 37061119
Lung Neoplasms Associate 21775533
Neoplasms Associate 34913069