ZPLD1 (zona pellucida like domain containing 1)

Gene

• Entrez ID: 131368
• Gene name: Zona pellucida like domain containing 1
• Gene symbol: ZPLD1
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3q12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018809	hsa-miR-335-5p	Microarray	18185580
MIRT019492	hsa-miR-148b-3p	Microarray	17612493
MIRT1543377	hsa-miR-153	CLIP-seq
MIRT1543378	hsa-miR-19a	CLIP-seq
MIRT1543379	hsa-miR-19b	CLIP-seq
MIRT1543380	hsa-miR-223	CLIP-seq
MIRT1543381	hsa-miR-2278	CLIP-seq
MIRT1543382	hsa-miR-3545-3p	CLIP-seq
MIRT1543383	hsa-miR-3925-3p	CLIP-seq
MIRT1543384	hsa-miR-3926	CLIP-seq
MIRT1543385	hsa-miR-4459	CLIP-seq
MIRT1543386	hsa-miR-448	CLIP-seq
MIRT1543387	hsa-miR-452	CLIP-seq
MIRT1543388	hsa-miR-4539	CLIP-seq
MIRT1543389	hsa-miR-4676-3p	CLIP-seq
MIRT1543390	hsa-miR-4762-5p	CLIP-seq
MIRT1543391	hsa-miR-4772-3p	CLIP-seq
MIRT1543392	hsa-miR-4777-3p	CLIP-seq
MIRT1543393	hsa-miR-4799-5p	CLIP-seq
MIRT1543394	hsa-miR-515-5p	CLIP-seq
MIRT1543395	hsa-miR-520a-5p	CLIP-seq
MIRT1543396	hsa-miR-525-5p	CLIP-seq
MIRT1543397	hsa-miR-646	CLIP-seq
MIRT1543398	hsa-miR-766	CLIP-seq
MIRT1543399	hsa-miR-935	CLIP-seq
MIRT2383128	hsa-miR-377	CLIP-seq
MIRT2383129	hsa-miR-5096	CLIP-seq
MIRT2464756	hsa-miR-3185	CLIP-seq
MIRT2464757	hsa-miR-548a-3p	CLIP-seq
MIRT2464758	hsa-miR-548e	CLIP-seq
MIRT2464759	hsa-miR-548f	CLIP-seq
MIRT2673536	hsa-miR-148a	CLIP-seq
MIRT2673537	hsa-miR-148b	CLIP-seq
MIRT2673538	hsa-miR-152	CLIP-seq
MIRT1543377	hsa-miR-153	CLIP-seq
MIRT2673539	hsa-miR-2052	CLIP-seq
MIRT2673540	hsa-miR-375	CLIP-seq
MIRT2673541	hsa-miR-4276	CLIP-seq
MIRT2673536	hsa-miR-148a	CLIP-seq
MIRT2673537	hsa-miR-148b	CLIP-seq
MIRT2673538	hsa-miR-152	CLIP-seq
MIRT1543377	hsa-miR-153	CLIP-seq
MIRT2673539	hsa-miR-2052	CLIP-seq
MIRT2673540	hsa-miR-375	CLIP-seq
MIRT2673541	hsa-miR-4276	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0060005	Process	Vestibular reflex	IEA

Other IDs

• MIM: 615915
• HGNC: 27022
• e!Ensembl: ENSG00000170044

Protein

• UniProt ID: Q8TCW7
• Protein name: Zona pellucida-like domain-containing protein 1 (ZP domain-containing protein 1) (Cupulin) [Cleaved into: Zona pellucida-like domain-containing protein 1, secreted form]
• Protein function: Glycoprotein which is a component of the gelatinous extracellular matrix in the cupulae of the vestibular organ.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00100	Zona_pellucida	44 → 314	Zona pellucida-like domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in placenta, kidney, lung, pancreas and at very low level in other tissues. {ECO:0000269|PubMed:18632209}.
• Sequence:

  MEQIWLLLLLTIRVLPGSAQFNGYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLF
  SGYSETDLALNGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVSAYG
  NATSVQVGNISGYIDTPDPPTIISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVREN
  NGTFVSTLNLLLYNDSTYNQQLIIPSIGLPLKTKVFAAVQATNLDGRWNVLMDYCYTTPS
  GNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKL
  CRADDCPFLMPICSHRERRDAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSP
  SMPPFQLNAITSALISGMVILGVTSFSLLLCSLALLHRKGPTSLVLNGIRNPVFD

• Sequence length: 415

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMBLYOPIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Hypesthesia	Associate	23834954	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	20950786	★☆☆☆☆ Found in Text Mining only
Paresthesia	Associate	23834954	★☆☆☆☆ Found in Text Mining only