Gene Gene information from NCBI Gene database.
Entrez ID 1312
Gene name Catechol-O-methyltransferase
Gene symbol COMT
Synonyms (NCBI Gene)
HEL-S-98n
Chromosome 22
Chromosome location 22q11.21
Summary Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathwa
SNPs SNP information provided by dbSNP.
25
SNP ID Visualize variation Clinical significance Consequence
rs4646315 G>A,C Drug-response Intron variant
rs144623972 G>A,C Drug-response Upstream transcript variant, intron variant, genic upstream transcript variant
rs188159376 C>T Drug-response Intron variant, genic upstream transcript variant
rs972946462 C>T Drug-response Intron variant, upstream transcript variant, genic upstream transcript variant
rs1601511512 A>T Drug-response 5 prime UTR variant, genic upstream transcript variant, upstream transcript variant, intron variant
miRNA miRNA information provided by mirtarbase database.
191
miRTarBase ID miRNA Experiments Reference
MIRT031679 hsa-miR-16-5p Proteomics 18668040
MIRT031679 hsa-miR-16-5p CLASH 23622248
MIRT756304 hsa-miR-30a-5p Immunoprecipitaion (IP) 38427212
MIRT756305 hsa-miR-34a-5p Immunoprecipitaion (IP) 38427212
MIRT903650 hsa-miR-3647-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
87
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IEA
GO:0001662 Process Behavioral fear response IEA
GO:0001666 Process Response to hypoxia IEA
GO:0001822 Process Kidney development IEA
GO:0001963 Process Synaptic transmission, dopaminergic IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
116790 2228 ENSG00000093010
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P21964
Protein name Catechol O-methyltransferase (EC 2.1.1.6)
Protein function Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. {ECO:000
PDB 3A7E , 3BWM , 3BWY , 4PYI , 4PYJ , 4PYK , 4XUC , 4XUD , 4XUE , 5LSA , 6I3C , 6I3D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01596 Methyltransf_3 67 228 O-methyltransferase Domain
Tissue specificity TISSUE SPECIFICITY: Brain, liver, placenta, lymphocytes and erythrocytes.
Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPD
FLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Sequence length 271
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
  Methylation
Enzymatic degradation of dopamine by COMT
Enzymatic degradation of Dopamine by monoamine oxidase
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
182
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Bardet-Biedl syndrome Pathogenic rs2517476743 RCV003224777
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
22q11.2 deletion syndrome Uncertain significance rs6267 RCV005357146
COMT POLYMORPHISM Benign rs4680 RCV000019156
COMT-related disorder Likely benign; Benign rs745542046, rs1277428084, rs1601526844, rs762482920, rs8192488, rs3218737 RCV003943884
RCV003949252
RCV003946774
RCV003962249
RCV003972942
RCV003922866
methamphetamine use disorder Benign rs4818 RCV003313783
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
22q11 Deletion Syndrome Inhibit 17028864
22q11 Deletion Syndrome Associate 17217925
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 19406978
Abdominal Pain Associate 28252569
Acute Coronary Syndrome Associate 17205121, 17264883
Acute Kidney Injury Associate 19406978, 29426301
Acute Pain Associate 25102390, 29195501, 32162598, 38408640
Agoraphobia Associate 38228118
AIDS Associated Nephropathy Associate 26037113, 31021849
Akathisia Drug Induced Associate 22615781