Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1312
Gene name Gene Name - the full gene name approved by the HGNC.
Catechol-O-methyltransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COMT
Synonyms (NCBI Gene) Gene synonyms aliases
HEL-S-98n
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q11.21
Summary Summary of gene provided in NCBI Entrez Gene.
Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathwa
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs4646315 G>A,C Drug-response Intron variant
rs144623972 G>A,C Drug-response Upstream transcript variant, intron variant, genic upstream transcript variant
rs188159376 C>T Drug-response Intron variant, genic upstream transcript variant
rs972946462 C>T Drug-response Intron variant, upstream transcript variant, genic upstream transcript variant
rs1601511512 A>T Drug-response 5 prime UTR variant, genic upstream transcript variant, upstream transcript variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT031679 hsa-miR-16-5p Proteomics 18668040
MIRT031679 hsa-miR-16-5p CLASH 23622248
MIRT756304 hsa-miR-30a-5p Immunoprecipitaion (IP) 38427212
MIRT756305 hsa-miR-34a-5p Immunoprecipitaion (IP) 38427212
MIRT903650 hsa-miR-3647-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IEA
GO:0005515 Function Protein binding IPI 16189514, 19060904, 32296183, 32814053
GO:0005829 Component Cytosol TAS
GO:0005886 Component Plasma membrane TAS
GO:0008168 Function Methyltransferase activity TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
116790 2228 ENSG00000093010
Protein
UniProt ID P21964
Protein name Catechol O-methyltransferase (EC 2.1.1.6)
Protein function Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. {ECO:000
PDB 3A7E , 3BWM , 3BWY , 4PYI , 4PYJ , 4PYK , 4XUC , 4XUD , 4XUE , 5LSA , 6I3C , 6I3D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01596 Methyltransf_3 67 228 O-methyltransferase Domain
Tissue specificity TISSUE SPECIFICITY: Brain, liver, placenta, lymphocytes and erythrocytes.
Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPD
FLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Sequence length 271
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
  Methylation
Enzymatic degradation of dopamine by COMT
Enzymatic degradation of Dopamine by monoamine oxidase
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Atrial septal defect Atrial Septal Defects rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074
View all (25 more)
Attention deficit hyperactivity disorder Attention Deficit Disorder, Attention deficit hyperactivity disorder rs786205019 10490706
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
16917939
Unknown
Disease term Disease name Evidence References Source
22q11.2 deletion syndrome 22q11.2 deletion syndrome ClinVar
Asthma Asthma ClinVar
Behavior disorders Behavior Disorders 16780746 ClinVar
Chronic obstructive pulmonary disease Chronic Obstructive Airway Disease ClinVar
Associations from Text Mining
Disease Name Relationship Type References
22q11 Deletion Syndrome Inhibit 17028864
22q11 Deletion Syndrome Associate 17217925
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 19406978
Abdominal Pain Associate 28252569
Acute Coronary Syndrome Associate 17205121, 17264883
Acute Kidney Injury Associate 19406978, 29426301
Acute Pain Associate 25102390, 29195501, 32162598, 38408640
Agoraphobia Associate 38228118
AIDS Associated Nephropathy Associate 26037113, 31021849
Akathisia Drug Induced Associate 22615781