FAM3D (FAM3 metabolism regulating signaling molecule D)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
131177
Gene name Gene Name - the full gene name approved by the HGNC.
FAM3 metabolism regulating signaling molecule D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FAM3D
Synonyms (NCBI Gene) Gene synonyms aliases
EF7, OIT1
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p14.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(16)
miRTarBase ID miRNA Experiments Reference
MIRT713847 hsa-miR-6835-3p HITS-CLIP 19536157
MIRT713846 hsa-miR-6871-3p HITS-CLIP 19536157
MIRT713845 hsa-miR-1324 HITS-CLIP 19536157
MIRT713844 hsa-miR-140-3p HITS-CLIP 19536157
MIRT713843 hsa-miR-6845-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity NAS 12160727
GO:0005576 Component Extracellular region NAS 12160727
GO:0005615 Component Extracellular space IBA 21873635
GO:0007165 Process Signal transduction IEA
GO:0046676 Process Negative regulation of insulin secretion IDA 12160727
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
608619 18665 ENSG00000198643
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96BQ1
Protein name Protein FAM3D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15711 ILEI 99 → 187 Interleukin-like EMT inducer Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in placenta and weakly expressed in small intestine. {ECO:0000269|PubMed:12160727}.
Sequence 
MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKP
CPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFD
MYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWV
FIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF
Sequence length 224
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 21822266
Show/Hide Text Mining Associations (9)
Associations from Text Mining
Disease Name Relationship Type References
Colorectal Neoplasms Inhibit 31147452
Diabetes Mellitus Type 2 Associate 36524461
Endometrial Neoplasms Associate 35351056
Lymphatic Metastasis Inhibit 36510584
Nasal Polyps Associate 32047813
Nasopharyngeal Carcinoma Associate 33564686
Neoplasms Associate 36510584
Pancreatic Neoplasms Associate 37338014
Squamous Cell Carcinoma of Head and Neck Associate 36510584