FAM3D (FAM3 metabolism regulating signaling molecule D)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 131177
Gene name FAM3 metabolism regulating signaling molecule D
Gene symbol FAM3D
Synonyms (NCBI Gene)
EF7OIT1
Chromosome 3
Chromosome location 3p14.2
miRNA miRNA information provided by mirtarbase database.
16
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (16)
miRTarBase ID miRNA Experiments Reference
MIRT713847 hsa-miR-6835-3p HITS-CLIP 19536157
MIRT713846 hsa-miR-6871-3p HITS-CLIP 19536157
MIRT713845 hsa-miR-1324 HITS-CLIP 19536157
MIRT713844 hsa-miR-140-3p HITS-CLIP 19536157
MIRT713843 hsa-miR-6845-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (13)
GO ID Ontology Definition Evidence Reference
GO:0001780 Process Neutrophil homeostasis IEA
GO:0002618 Process Positive regulation of macrophage antigen processing and presentation IEA
GO:0005125 Function Cytokine activity NAS 12160727
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
608619 18665 ENSG00000198643
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96BQ1
Protein name Protein FAM3D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15711 ILEI 99 → 187 Interleukin-like EMT inducer Domain
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in placenta and weakly expressed in small intestine. {ECO:0000269|PubMed:12160727}.
Sequence 
MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKP
CPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFD
MYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWV
FIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF
Sequence length 224
Interactions View interactions