Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
131118
Gene name Gene Name - the full gene name approved by the HGNC.
DnaJ heat shock protein family (Hsp40) member C19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAJC19
Synonyms (NCBI Gene) Gene synonyms aliases
PAM18, TIM14, TIMM14
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q26.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is thought to be part of a complex involved in the ATP-dependent transport of transit peptide-containing proteins from the inner cell membrane to the mitochondrial matrix. Defects in this gene are a cause of 3-methylglutac
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137854888 C>G Pathogenic Intron variant, splice acceptor variant
rs141007488 G>A Conflicting-interpretations-of-pathogenicity Missense variant, intron variant, non coding transcript variant, coding sequence variant
rs587777224 T>- Pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
rs878852999 C>T Likely-pathogenic Splice acceptor variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001552 hsa-miR-155-5p pSILAC 18668040
MIRT001552 hsa-miR-155-5p qRT-PCR 20584899
MIRT024336 hsa-miR-215-5p Microarray 19074876
MIRT026867 hsa-miR-192-5p Microarray 19074876
MIRT045573 hsa-miR-149-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001405 Component PAM complex, Tim23 associated import motor IBA 21873635
GO:0001671 Function ATPase activator activity IBA 21873635
GO:0005515 Function Protein binding IPI 19564938, 20053669
GO:0005739 Component Mitochondrion IDA 12592411
GO:0005743 Component Mitochondrial inner membrane IDA 20053669
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608977 30528 ENSG00000205981
Protein
UniProt ID Q96DA6
Protein name Mitochondrial import inner membrane translocase subunit TIM14 (DnaJ homolog subfamily C member 19)
Protein function Mitochondrial co-chaperone which forms a complex with prohibitins to regulate cardiolipin remodeling (By similarity). May be a component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 65 116 DnaJ domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed.
Sequence
MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTK
REAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Sequence length 116
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
3-methylglutaconic aciduria 3-@METHYLGLUTACONIC ACIDURIA, TYPE V, 3-methylglutaconic aciduria type 5 rs137854888, rs80356523, rs80356526, rs121434636, rs730880309, rs730880310, rs730880311, rs730880312, rs199474657, rs1603377590, rs104894941, rs2147483647, rs132630277, rs1603377747, rs1603376833
View all (64 more)
22797137, 16055927, 27928778, 27426421
Anemia Microcytic hypochromic anemia (disorder) rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Cardiomyopathy Cardiomyopathy, Dilated rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
Cryptorchidism Cryptorchidism, Bilateral Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure ClinVar
Associations from Text Mining
Disease Name Relationship Type References
3 Methylglutaconic Aciduria Associate 27485409
3 Methylglutaconic Aciduria Type V Associate 16055927, 32521499, 38142971
Ataxia Associate 27330077
Barth Syndrome Associate 16055927
Carcinoma Ovarian Epithelial Associate 33173439
Cardiomyopathies Associate 38142971
Cardiomyopathy Dilated Associate 20053669, 27330077
Genetic Diseases Inborn Associate 20053669
Heart Diseases Associate 20053669
Mitochondrial Diseases Associate 38142971