ZFAND2B (zinc finger AN1-type containing 2B)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 130617
Gene name Zinc finger AN1-type containing 2B
Gene symbol ZFAND2B
Synonyms (NCBI Gene)
AIRAPL
Chromosome 2
Chromosome location 2q35
Summary This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants
miRNA miRNA information provided by mirtarbase database.
38
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (38)
miRTarBase ID miRNA Experiments Reference
MIRT487003 hsa-miR-6753-5p PAR-CLIP 23592263
MIRT487002 hsa-miR-6750-5p PAR-CLIP 23592263
MIRT487001 hsa-miR-6822-5p PAR-CLIP 23592263
MIRT487000 hsa-miR-7160-3p PAR-CLIP 23592263
MIRT486999 hsa-miR-181a-2-3p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (25)
GO ID Ontology Definition Evidence Reference
GO:0000502 Component Proteasome complex IDA 26876100
GO:0000502 Component Proteasome complex IEA
GO:0005515 Function Protein binding IPI 16189514, 19060904, 25416956, 26876100, 31515488, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005783 Component Endoplasmic reticulum IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613474 25206 ENSG00000158552
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WV99
Protein name AN1-type zinc finger protein 2B (Arsenite-inducible RNA-associated protein-like protein) (AIRAP-like protein)
Protein function Plays a role in protein homeostasis by regulating both the translocation and the ubiquitin-mediated proteasomal degradation of nascent proteins at the endoplasmic reticulum. It is involved in the regulation of signal-mediated translocation of pr
PDB 1X4V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01428 zf-AN1 10 → 49 AN1-like Zinc finger Family
PF01428 zf-AN1 100 → 139 AN1-like Zinc finger Family
Sequence 
MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLC
NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSR
NFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTR
SPSWTAPPVIALQNGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQ
RQQAQSRSSKPSNCSLC
Sequence length 257
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Uncertain significance rs373368661 RCV005932200