Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
130617
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger AN1-type containing 2B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFAND2B
Synonyms (NCBI Gene) Gene synonyms aliases
AIRAPL
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q35
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT487003 hsa-miR-6753-5p PAR-CLIP 23592263
MIRT487002 hsa-miR-6750-5p PAR-CLIP 23592263
MIRT487001 hsa-miR-6822-5p PAR-CLIP 23592263
MIRT487000 hsa-miR-7160-3p PAR-CLIP 23592263
MIRT486999 hsa-miR-181a-2-3p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000502 Component Proteasome complex IDA 26876100
GO:0000502 Component Proteasome complex IEA
GO:0005515 Function Protein binding IPI 16189514, 19060904, 25416956, 26876100, 31515488, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005783 Component Endoplasmic reticulum IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613474 25206 ENSG00000158552
Protein
UniProt ID Q8WV99
Protein name AN1-type zinc finger protein 2B (Arsenite-inducible RNA-associated protein-like protein) (AIRAP-like protein)
Protein function Plays a role in protein homeostasis by regulating both the translocation and the ubiquitin-mediated proteasomal degradation of nascent proteins at the endoplasmic reticulum. It is involved in the regulation of signal-mediated translocation of pr
PDB 1X4V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01428 zf-AN1 10 49 AN1-like Zinc finger Family
PF01428 zf-AN1 100 139 AN1-like Zinc finger Family
Sequence
MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLC
NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSR
NFCIKHRHPLDHDCSGEGH
PTSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTR
SPSWTAPPVIALQNGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQ
RQQAQSRSSKPSNCSLC
Sequence length 257
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS