ZFAND2B (zinc finger AN1-type containing 2B)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
130617
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger AN1-type containing 2B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFAND2B
Synonyms (NCBI Gene) Gene synonyms aliases
AIRAPL
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q35
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(38)
miRTarBase ID miRNA Experiments Reference
MIRT487003 hsa-miR-6753-5p PAR-CLIP 23592263
MIRT487002 hsa-miR-6750-5p PAR-CLIP 23592263
MIRT487001 hsa-miR-6822-5p PAR-CLIP 23592263
MIRT487000 hsa-miR-7160-3p PAR-CLIP 23592263
MIRT486999 hsa-miR-181a-2-3p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0000502 Component Proteasome complex IDA 26876100
GO:0005515 Function Protein binding IPI 16189514, 19060904, 25416956, 26876100, 31515488, 32296183
GO:0005783 Component Endoplasmic reticulum ISS
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0006616 Process SRP-dependent cotranslational protein targeting to membrane, translocation IMP 24160817
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613474 25206 ENSG00000158552
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8WV99
Protein name AN1-type zinc finger protein 2B (Arsenite-inducible RNA-associated protein-like protein) (AIRAP-like protein)
Protein function Plays a role in protein homeostasis by regulating both the translocation and the ubiquitin-mediated proteasomal degradation of nascent proteins at the endoplasmic reticulum. It is involved in the regulation of signal-mediated translocation of pr
PDB 1X4V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01428 zf-AN1 10 → 49 AN1-like Zinc finger Family
PF01428 zf-AN1 100 → 139 AN1-like Zinc finger Family
Sequence 
MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLC
NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSR
NFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTR
SPSWTAPPVIALQNGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQ
RQQAQSRSSKPSNCSLC
Sequence length 257
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 26198764