Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1299
Gene name Gene Name - the full gene name approved by the HGNC.
Collagen type IX alpha 3 chain
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COL9A3
Synonyms (NCBI Gene) Gene synonyms aliases
DJ885L7.4.1, EDM3, IDD, MED, STL6
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations i
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs61734651 C>T Risk-factor, likely-benign, benign Coding sequence variant, missense variant
rs146578812 C>G,T Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant, 3 prime UTR variant, synonymous variant
rs150153886 C>T Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, synonymous variant
rs606231367 G>A Pathogenic Splice acceptor variant
rs747896279 C>A,T Pathogenic Intron variant, coding sequence variant, stop gained, synonymous variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018445 hsa-miR-335-5p Microarray 18185580
MIRT903251 hsa-miR-129-5p CLIP-seq
MIRT903252 hsa-miR-3137 CLIP-seq
MIRT903253 hsa-miR-3664-5p CLIP-seq
MIRT903254 hsa-miR-4714-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005581 Component Collagen trimer IEA
GO:0005594 Component Collagen type IX trimer IBA
GO:0005594 Component Collagen type IX trimer IDA 8660302
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
120270 2219 ENSG00000092758
Protein
UniProt ID Q14050
Protein name Collagen alpha-3(IX) chain
Protein function Structural component of hyaline cartilage and vitreous of the eye.
PDB 5CTD , 5CTI , 5CVA , 5CVB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01391 Collagen 24 84 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 62 118 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 178 237 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 349 426 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 460 522 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 549 610 Collagen triple helix repeat (20 copies) Repeat
Sequence
MAGPRACAPLLLLLLLGELLAAAGAQRVGLPGPPGPPGPPGKPGQDGIDGEAGPPGLPGP
P
GPKGAPGKPGKPGEAGLPGLPGVDGLTGRDGPPGPKGAPGERGSLGPPGPPGLGGKGLP
GPPGEAGVSGPPGGIGLRGPPGPSGLPGLPGPPGPPGPPGHPGVLPEGATDLQCPSICPP
GPPGPPGMPGFKGPTGYKGEQGEVGKDGEKGDPGPPGPAGLPGSVGLQGPRGLRGLP
GPL
GPPGDRGPIGFRGPPGIPGAPGKAGDRGERGPEGFRGPKGDLGRPGPKGTPGVAGPSGEP
GMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGLPGRAGSKGEKGERGRAGELGEA
GPSGEPGVPGDAGMPGERGEAGHRGSAGALGPQGPPGAPGVRGFQGQKGSMGDPGLPGPQ
GLRGDV
GDRGPGGAAGPKGDQGIAGSDGLPGDKGELGPSGLVGPKGESGSRGELGPKGTQ
GPNGTSGVQGVPGPPGPLGLQGVPGVPGITGKPGVPGKEASE
QRIRELCGGMISEQIAQL
AAHLRKPLAPGSIGRPGPAGPPGPPGPPGSIGHPGARGPPGYRGPTGELGDPGPRGNQGD
RGDKGAAGAG
LDGPEGDQGPQGPQGVPGTSKDGQDGAPGEPGPPGDPGLPGAIGAQGTPG
ICDTSACQGAVLGGVGEKSGSRSS
Sequence length 684
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cytoskeleton in muscle cells
Protein digestion and absorption
Human papillomavirus infection
  Collagen biosynthesis and modifying enzymes
Signaling by PDGF
Assembly of collagen fibrils and other multimeric structures
Integrin cell surface interactions
ECM proteoglycans
NCAM1 interactions
Collagen chain trimerization
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Epiphyseal dysplasia epiphyseal dysplasia, multiple, 3 rs606231367, rs1555821817, rs1600786629, rs1600786748 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Connective Tissue Disease Connective tissue disorder N/A N/A ClinVar
Multiple Epiphyseal Dysplasia Multiple Epiphyseal Dysplasia, Dominant N/A N/A ClinVar
stickler syndrome Stickler syndrome N/A N/A ClinVar
Stickler syndrome Stickler syndrome, Stickler syndrome, type 6 N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adrenoleukodystrophy Associate 29476661
Alport Syndrome Mental Retardation Midface Hypoplasia and Elliptocytosis Associate 33633367
Carcinoma Squamous Cell Associate 33691689
Diabetes Mellitus Type 2 Associate 28427244
Encephalocele Associate 21311409
Fibrocartilaginous embolism Associate 16133074, 32943704
Fractures Bone Associate 21311409
Fused Kidney Associate 21311409
Hearing Loss Associate 33078831
Hearing Loss Sensorineural Associate 33570243, 33633367