Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	129831
Gene name	RNA binding motif protein 45
Gene symbol	RBM45
Synonyms (NCBI Gene)	DRB1RB-1
Chromosome	2
Chromosome location	2q31.2
Summary	This gene encodes a member of the RNA recognition motif (RRM)-type RNA-binding family of proteins. This protein exhibits preferential binding to poly(C) RNA. Initial cloning of this gene found that the rat ortholog was dynamically expressed in the develop

Show/Hide all (34)

miRTarBase ID	miRNA	Experiments
MIRT1296348	hsa-miR-1185	CLIP-seq
MIRT1296349	hsa-miR-1207-3p	CLIP-seq
MIRT1296350	hsa-miR-2115	CLIP-seq
MIRT1296351	hsa-miR-23a	CLIP-seq
MIRT1296352	hsa-miR-23b	CLIP-seq
MIRT1296353	hsa-miR-23c	CLIP-seq
MIRT1296354	hsa-miR-3159	CLIP-seq
MIRT1296355	hsa-miR-3605-5p	CLIP-seq
MIRT1296356	hsa-miR-3679-5p	CLIP-seq
MIRT1296357	hsa-miR-4666-5p	CLIP-seq
MIRT1296358	hsa-miR-4672	CLIP-seq
MIRT1296359	hsa-miR-4704-3p	CLIP-seq
MIRT1296360	hsa-miR-4718	CLIP-seq
MIRT1296361	hsa-miR-516a-3p	CLIP-seq
MIRT1296362	hsa-miR-545	CLIP-seq
MIRT1296359	hsa-miR-4704-3p	CLIP-seq
MIRT1296348	hsa-miR-1185	CLIP-seq
MIRT1296349	hsa-miR-1207-3p	CLIP-seq
MIRT1296351	hsa-miR-23a	CLIP-seq
MIRT1296352	hsa-miR-23b	CLIP-seq
MIRT1296353	hsa-miR-23c	CLIP-seq
MIRT1296354	hsa-miR-3159	CLIP-seq
MIRT1296355	hsa-miR-3605-5p	CLIP-seq
MIRT1296356	hsa-miR-3679-5p	CLIP-seq
MIRT1296359	hsa-miR-4704-3p	CLIP-seq
MIRT2312974	hsa-miR-616	CLIP-seq
MIRT1296358	hsa-miR-4672	CLIP-seq
MIRT1296360	hsa-miR-4718	CLIP-seq
MIRT1296348	hsa-miR-1185	CLIP-seq
MIRT1296349	hsa-miR-1207-3p	CLIP-seq
MIRT1296354	hsa-miR-3159	CLIP-seq
MIRT1296355	hsa-miR-3605-5p	CLIP-seq
MIRT1296356	hsa-miR-3679-5p	CLIP-seq
MIRT1296359	hsa-miR-4704-3p	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	12220514
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 26979993, 32296183, 32814053, 33961781, 39251607
GO:0005634	Component	Nucleus	IDA	12220514
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	12220514
GO:0005737	Component	Cytoplasm	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:1990904	Component	Ribonucleoprotein complex	IBA

MIM	HGNC	e!Ensembl
608888	24468	ENSG00000155636

Q8IUH3

Protein name

RNA-binding protein 45 (Developmentally-regulated RNA-binding protein 1) (RB-1) (RNA-binding motif protein 45)

Protein function

RNA-binding protein with binding specificity for poly(C). May play an important role in neural development.

PDB

7CSX , 7CSZ , 8WQ3 , 8WQ5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	31 → 97	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	113 → 186	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	257 → 317	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	396 → 458	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Sequence

MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDK
HTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEEL
TRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIEN
CDRSFRAILAEPKNKASESSEQDYYSNMRQEALGHEPRVNMFPFVGEQQSEFSSFDKNDS
RGQEAISKRLSVVSRVPFTEEQLFSIFDIVPGLEYCEVQRDPYSNYGHGVVQYFNVASAI
YAKYKLHGFQYPPGNRIGVSFIDDGSNATDLLRKMATQMVAAQLASMVWNNPSQQQFMQF
GGSSGSQLPQIQTDVVLPSCKKKAPAETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIE
VYLVSGKNVGYAKYADRISANDAIATLHGKILNGVRLKVMLADSPREESNKRQRTY

Sequence length

476

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BENIGN CHONDROGENIC NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE BENIGN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	22993125	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Associate	22993125, 26391765, 29140459, 33577684, 34118419	★★★★★ ★☆☆☆☆ Found in Text Mining only
DNA Virus Infections	Associate	29140459	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolism Fat	Associate	30901032	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Associate	33577684, 34118419	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Associate	22993125, 26391765	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	33577684, 36789492	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurologic Manifestations	Associate	30992467	★★★★★ ★☆☆☆☆ Found in Text Mining only
TDP 43 Proteinopathies	Associate	36789492	★★★★★ ★☆☆☆☆ Found in Text Mining only

RBM45 (RNA binding motif protein 45)