Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1297
Gene name Gene Name - the full gene name approved by the HGNC.
Collagen type IX alpha 1 chain
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COL9A1
Synonyms (NCBI Gene) Gene synonyms aliases
DJ149L1.1.2, EDM6, MED, STL4
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component of hyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen. Studies in knockout mice
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121912931 G>A Pathogenic Non coding transcript variant, upstream transcript variant, genic upstream transcript variant, stop gained, coding sequence variant
rs143848379 C>T Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, intron variant, genic upstream transcript variant, missense variant
rs146700420 G>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, upstream transcript variant, genic upstream transcript variant, missense variant
rs149830493 A>T Pathogenic, conflicting-interpretations-of-pathogenicity Splice donor variant, upstream transcript variant, genic upstream transcript variant
rs189754995 G>A,T Pathogenic Coding sequence variant, non coding transcript variant, synonymous variant, stop gained, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT610835 hsa-miR-8485 HITS-CLIP 23824327
MIRT610834 hsa-miR-4789-3p HITS-CLIP 23824327
MIRT610833 hsa-miR-6773-3p HITS-CLIP 23824327
MIRT610832 hsa-miR-215-3p HITS-CLIP 23824327
MIRT610835 hsa-miR-8485 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15047691, 32814053, 33961781
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005581 Component Collagen trimer IEA
GO:0005594 Component Collagen type IX trimer IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
120210 2217 ENSG00000112280
Protein
UniProt ID P20849
Protein name Collagen alpha-1(IX) chain
Protein function Structural component of hyaline cartilage and vitreous of the eye.
PDB 2UUR , 5CTD , 5CTI , 5CVA , 5CVB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01391 Collagen 266 326 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 303 358 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 357 409 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 415 474 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 454 531 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 643 716 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 697 760 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 785 849 Collagen triple helix repeat (20 copies) Repeat
Sequence
MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLI
SQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMT
GSTLKKNWNIWQIQDSSGKEQVGIKINGQTQSVVFSYKGLDGSLQTAAFSNLSSLFDSQW
HKIMIGVERSSATLFVDCNRIESLPIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLI
HCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP
PG
PPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIP
GPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDP
LCPNACPPGRS
GYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQ
GELGEVGAQGPPGAQGLRGITGIVGDK
GEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEGARGIPGLP
GPKGDTGLP
GVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQM
GNSGKPGQQGPPGEVGPRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPGLP
GMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDI
GLPGPKGSAGNPGEPGLRGPEGSR
GLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQ
HIKQVCMRVIQEHFAEMAAS
LKRPDSGATGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEK
GERGPPGRG
PNGLPGAIGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLPGF
CEPASCTMQAGQRAFNKGPDP
Sequence length 921
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cytoskeleton in muscle cells
Protein digestion and absorption
Human papillomavirus infection
  Collagen biosynthesis and modifying enzymes
Signaling by PDGF
Assembly of collagen fibrils and other multimeric structures
Integrin cell surface interactions
ECM proteoglycans
NCAM1 interactions
Collagen chain trimerization
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Connective Tissue Disease Connective tissue disorder rs189754995 N/A
Stickler Syndrome Stickler syndrome, type 4 rs201035486, rs121912931, rs189754995 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Epiphyseal dysplasia epiphyseal dysplasia, multiple, 6 N/A N/A ClinVar
hearing impairment Hearing impairment N/A N/A ClinVar
Marfan Syndrome marfan syndrome N/A N/A ClinVar
Multiple Epiphyseal Dysplasia Multiple Epiphyseal Dysplasia, Dominant N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
alpha Thalassemia Associate 17301974
Carcinoma Squamous Cell Associate 30657779
Cardiomyopathy Dilated Associate 27936202
Cartilage Diseases Associate 26973327, 27819742
Clubfoot Associate 27819742
Collagenopathy type 2 alpha 1 Associate 33951325
Hearing Loss Associate 31315069
Hypoxia Stimulate 25510649
Insulin Resistance Associate 27477082
Kashin Beck Disease Associate 25774918